CATH Domain: 3cc6A01 XML data for domain: 3cc6A01

Molscript image for 3cc6A01
3cc6A01
PDB coordinates for domain 3cc6A01

PDB 3cc6, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.200 Phosphorylase Kinase; domain 1
3.30.200.20 Phosphorylase Kinase; domain 1 Gene3D
3.30.200.20.13
3.30.200.20.13.1
3.30.200.20.13.1.1
3.30.200.20.13.1.1.1
3.30.200.20.13.1.1.1.1

[top]
Segment boundaries for domain 3cc6A01

Chopping figure for domain 3cc6A01
DomainStart PDB ResidueStop PDB Residue
3cc6A01 415 504
3cc6A02 505 687

Structural Neighbourhood (58 entries)

There are 58 matching structural neighberhood comparisons for CATH ID 3.30.200.20.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 58 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3eqrB01 89.65 Activated CDC42 kinase 1GTPase inhibitor activitySmall GTPase mediated signal transductionHomo sapiensPositive regulation of peptidyl-tyrosine phosphorylation 3.30.200.20 91 31 97 2.61 2.67
1lufA01 89.50 Muscle, skeletal receptor tyrosine protein kinaseReceptor clusteringRattus norvegicusResponse to muscle activityMemory 3.30.200.20 97 30 92 2.73 2.94
1qpcA01 89.24 Pericentriolar materialPhosphoinositide 3-kinase bindingCD8 receptor bindingT cell receptor signaling pathwayCD4 receptor binding 3.30.200.20 88 35 93 2.38 2.55
3bceA01 88.90 Receptor tyrosine-protein kinase erbB-4Transmembrane receptor protein tyrosine kinase activityHomo sapiensBasolateral plasma membraneProtein binding 3.30.200.20 94 30 93 3.04 3.25
1xbbA01 88.71 T cell receptor complexTyrosine-protein kinase SYKOrgan morphogenesisLeukocyte cell-cell adhesionCell proliferation 3.30.200.20 83 38 91 1.79 1.96
2rgpA01 87.65 Calcium signaling pathwayPositive regulation of nitric oxide biosynthetic processEpidermal growth factor receptor activityResponse to UV-APositive regulation of cyclin-dependent protein kinase activity involved in G1/S 3.30.200.20 82 30 91 3.97 4.36
1fmkA03 87.47 Epithelial cell signaling in Helicobacter pylori infectionPositive regulation of integrin activationRegulation of bone resorptionProto-oncogene tyrosine-protein kinase SrcErbB signaling pathway 3.30.200.20 86 37 91 2.77 3.04
3blhA01 86.82 Transcription elongation from RNA polymerase II promoterCyclin-dependent protein kinase activityRNA polymerase II carboxy-terminal domain kinase activityProtein bindingCell proliferation 3.30.200.20 86 19 92 2.75 2.98
1opjA01 86.72 Protein domain specific bindingNucleusPeptidyl-tyrosine phosphorylationManganese ion bindingMus musculus 3.30.200.20 94 38 90 2.77 3.06
3e64A01 86.66 Jak-STAT signaling pathwayCellular component movementTyrosine-protein kinase JAK2Chemokine signaling pathwayAdipocytokine signaling pathway 3.30.200.20 93 27 95 3.18 3.32
3comB01 86.58 Transcription factor bindingPathways in cancerNon-small cell lung cancerCytoplasmSerine/threonine-protein kinase 4 3.30.200.20 85 25 88 2.45 2.76
1tkiA01 86.56 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 3.30.200.20 84 25 90 2.84 3.16
2acxA02 86.45 G protein-coupled receptor kinase 6Homo sapiensRegulation of G-protein coupled receptor protein signaling pathway 3.30.200.20 91 18 92 1.89 2.05
2wtkC01 86.29 NucleusSerine/threonine-protein kinase 11Cell cycle arrestProtein bindingSerine/threonine-protein kinase 11 [EC:2.7.11.9] 3.30.200.20 89 21 87 1.80 2.05
2rkuA01 86.23 Polo-like kinase 1 [EC:2.7.11.21]Polo kinase kinase activityProgesterone-mediated oocyte maturationCell proliferationOocyte meiosis 3.30.200.20 89 28 91 1.97 2.16
3d5vA01 86.04 Danio rerioPolo-like kinase 3.30.200.20 92 28 92 3.72 4.03
2j51A01 85.96 CytoplasmOocyte meiosisSTE20-like serine/threonine-protein kinasePlasma membraneHomo sapiens 3.30.200.20 90 25 95 3.91 4.09
2dylA01 85.89 Mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]MAP kinase kinase activityNeurotrophin signaling pathwayStress-activated MAPK cascadeT cell receptor signaling pathway 3.30.200.20 91 16 89 3.60 4.04
2r3iA01 85.67 Progesterone-mediated oocyte maturationPathways in cancerSmall cell lung cancerOocyte meiosisProstate cancer 3.30.200.20 76 27 81 2.64 3.25
2clqA01 85.62 Induction of apoptosis by extracellular signalsProtein homodimerization activityMitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]Neurotrophin signaling pathwayATP binding 3.30.200.20 85 23 84 2.03 2.40
2h6dA01 85.44 Insulin signaling pathwayHypertrophic cardiomyopathy (HCM)Adipocytokine signaling pathwayRegulation of autophagyMTOR signaling pathway 3.30.200.20 86 30 92 3.54 3.84
2evaA01 85.44 Positive regulation of T cell cytokine productionActivation of NF-kappaB-inducing kinase activityPositive regulation of interleukin-2 productionMitogen-activated protein kinase kinase kinase 7Protein binding 3.30.200.20 82 25 88 2.69 3.03
1s9jA01 85.33 Prion diseasesNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathwayErbB signaling pathway 3.30.200.20 86 18 93 3.48 3.73
3c4cA01 85.29 Neurotrophin signaling pathwayNon-small cell lung cancerCytoplasmErbB signaling pathwayProtein phosphorylation 3.30.200.20 86 22 92 3.33 3.61
3hmmA01 85.21 Type II transforming growth factor beta receptor bindingPeptidyl-threonine phosphorylationPositive regulation of cellular component movementPathway-restricted SMAD protein phosphorylationResponse to cholesterol 3.30.200.20 84 25 83 1.83 2.20
3f3zA01 85.06 Cryptosporidium parvum Iowa IICalcium-dependent protein kinase [EC:2.7.11.1]Calcium/calmodulin-dependent protein kinase with a kinase domain and 4 calmodulin like EF hands 3.30.200.20 81 33 88 2.44 2.75
3c0iA01 84.81 Actin cytoskeletonGuanylate kinase activityPeripheral plasma membrane protein CASKCell adhesionHomo sapiens 3.30.200.20 88 22 92 2.75 2.98
2vgpB01 84.80 Serine/threonine-protein kinase 12-AHistone H3-S10 phosphorylationChromosome, centromeric regionProtein bindingChromatin 3.30.200.20 89 22 91 2.40 2.63
2zv2A01 84.77 Calcium ion bindingRegulation of protein kinase activityPositive regulation of transcriptionMAPKKK cascadeCytoplasm 3.30.200.20 77 27 82 2.73 3.32
1fvrA01 84.54 Cell surfaceMicrovillusTransmembrane receptor protein tyrosine kinase signaling pathwayProtein bindingSignal transduction 3.30.200.20 86 19 93 3.85 4.12
3fhrA01 84.46 Response to stressMAP kinase kinase activityNucleusMitogen-activated protein kinase-activated protein kinase 3 [EC:2.7.11.1]MAPK signaling pathway 3.30.200.20 80 22 83 2.14 2.57
2oibA01 84.35 Chagas diseaseNeurotrophin signaling pathwayInterleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]ApoptosisHomo sapiens 3.30.200.20 93 23 83 3.35 3.99
2jamA01 84.27 Calcium/calmodulin-dependent protein kinase type 1GHomo sapiensCalcium/calmodulin-dependent protein kinase I [EC:2.7.11.17] 3.30.200.20 75 28 82 2.49 3.03
2weiA01 84.23 Cryptosporidium parvum Iowa IICalmodulin-domain protein kinase 1, putative 3.30.200.20 90 30 94 3.85 4.08
1zy4A01 84.23 Eukaryotic translation initiation factor 2alpha kinase activityProtein bindingSerine/threonine-protein kinase GCN2DNA damage checkpointRegulation of translational initiation 3.30.200.20 94 21 87 3.22 3.69
1ob3A01 84.08 Cyclin-dependent kinase [EC:2.7.11.22]Cell division control protein 2 homologPlasmodium falciparum K1 3.30.200.20 83 24 87 3.33 3.79
2ac3A01 84.05 MAP kinase-interacting serine/threonine-protein kinase 2ATP bindingProtein phosphorylationHomo sapiensProtein serine/threonine kinase activity 3.30.200.20 80 21 85 2.21 2.58
1xwsA01 83.94 Transcription factor bindingPositive regulation of cyclin-dependent protein kinase activity involved in G1/SManganese ion bindingNegative regulation of apoptosisProtein binding 3.30.200.20 92 22 86 2.42 2.78
1x8bA01 83.83 Homo sapiensWee1-like protein kinaseProtein binding 3.30.200.20 84 17 90 3.98 4.42
1u5qA01 83.48 Rattus norvegicusThousand and one amino acid protein kinase [EC:2.7.11.1]Serine/threonine-protein kinase TAO2MAPK signaling pathway 3.30.200.20 96 20 90 3.33 3.67
1q5kA01 83.41 Hedgehog signaling pathwayNeurotrophin signaling pathwayAlzheimer's diseaseT cell receptor signaling pathwayER overload response 3.30.200.20 95 23 85 3.51 4.12
1kobA01 82.85 Aplysia californicaTwitchin-like protein 3.30.200.20 109 22 78 3.64 4.61
2qkwB01 82.69 Solanum pimpinellifoliumProtein kinaseProtein binding 3.30.200.20 72 31 76 1.89 2.47
3g51A01 82.67 Progesterone-mediated oocyte maturationNeurotrophin signaling pathwayOocyte meiosisMAPK signaling pathwayLong-term potentiation 3.30.200.20 95 18 85 4.05 4.75
2j0iA01 82.25 Cellular component movementT cell receptor signaling pathwaySignal transductionProtein bindingRenal cell carcinoma 3.30.200.20 98 23 87 3.55 4.05
1omwA03 81.92 MembraneG-protein coupled receptor kinase activityNegative regulation of the force of heart contraction by chemical signalChemokine signaling pathwayMuscarinic acetylcholine receptor signaling pathway 3.30.200.20 107 21 76 2.11 2.75
3g0eA01 81.78 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Protein bindingAcute myeloid leukemia 3.30.200.20 131 31 68 2.80 4.08
2w5aA01 81.40 NIMA (never in mitosis gene a)-related kinase [EC:2.7.11.1]Regulation of mitosisSerine/threonine-protein kinase Nek2CentrosomeCentrosome separation 3.30.200.20 64 15 66 1.94 2.91
1ckiA01 81.32 SpindleRattus norvegicusHedgehog signaling pathwaySoluble fractionCircadian rhythm - mammal 3.30.200.20 64 25 67 1.87 2.76
2f57B01 80.75 T cell receptor signaling pathwayP21-activated kinase 7 [EC:2.7.11.1]Protein bindingRenal cell carcinomaErbB signaling pathway 3.30.200.20 106 24 81 3.40 4.19
1o6lA02 80.69 Jak-STAT signaling pathwayRAC-beta serine/threonine-protein kinaseNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathway 3.30.200.20 117 20 70 2.06 2.90
1rdqE02 80.46 Calcium signaling pathwayPrion diseasesProtein kinase A [EC:2.7.11.11]Olfactory transductionMesoderm formation 3.30.200.20 124 21 70 3.10 4.42
3h9rA01 80.34 Positive regulation of osteoblast differentiationBMP signaling pathwayActivin bindingNegative regulation of apoptosisNegative regulation of activin receptor signaling pathway 3.30.200.20 113 21 71 2.68 3.74
2oo8X01 79.89 Cell surfaceMicrovillusTransmembrane receptor protein tyrosine kinase signaling pathwayProtein bindingSignal transduction 3.30.200.20 60 26 62 1.85 2.97
2jedB01 78.28 Protein kinase C theta typeProtein bindingT cell receptor signaling pathwayNovel protein kinase C [EC:2.7.11.13]Adipocytokine signaling pathway 3.30.200.20 125 26 65 2.10 3.20
3a8xB01 77.52 Tight junctionInsulin signaling pathwayEndocytosisVesicle-mediated transportProtein binding 3.30.200.20 130 18 64 2.60 4.02
1kutB01 77.46 Thermotoga maritimaPhosphoribosylaminoimidazole-succinocarboxamide synthasePurine metabolismPhosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]Metabolic pathways 3.30.200.20 88 11 70 2.90 4.14
3kreA01 75.64 Phosphoribosylaminoimidazole-succinocarboxamide synthasePurine metabolismPhosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]Ehrlichia chaffeensis str. ArkansasMetabolic pathways 3.30.200.20 94 8 68 3.07 4.51
[1]
Displaying entries 1 to 58 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3cc6A01
GPQYGIAREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLIGIIE
EEPTWIIMEL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cc6A01
SMGGPQYGIAREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLIG
IIEEEPTWIIMEL
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 28 Apr 2009 11:57

Assigning to "3.30.200.20" based on similarity with "2etmA01"

Flow stage update by auto on 28 Apr 2009 11:54

No in_process hits for Domain "3cc6A01" ready to be processed

Update comment by auto on 28 Apr 2009 11:52

Domain "3cc6A01" hits Domain "3bz3A01" (51.1363636363636% over 94.6236559139785%) which is currently in process

Update comment by auto on 28 Apr 2009 11:49

Domain "3cc6A01" hits Domain "3bu3A01" (35.4838709677419% over 92.0792079207921%) which is currently in process

Update comment by auto on 28 Apr 2009 11:42

Domain "3cc6A01" hits Domain "3bu5A01" (35.4838709677419% over 92.0792079207921%) which is currently in process

Update comment by auto on 28 Apr 2009 11:29

Domain "3cc6A01" hits Domain "3bkbA02" (40% over 91.3978494623656%) which is currently in process

Update comment by auto on 28 Apr 2009 11:10

Domain "3cc6A01" hits Domain "3cblA02" (40% over 91.3978494623656%) which is currently in process

Flow stage update by auto on 28 Apr 2009 11:08

Domain "3cc6A01" hits Domain "3cblA02" (40% over 91.3978494623656%) which is currently in process

Flow stage update by auto on 28 Apr 2009 11:08

NW result present for Domain "3cc6A01"

Flow stage update by auto on 20 Apr 2009 08:14

All required files are present for Domain "3cc6A01"

Flow stage update by auto on 01 Apr 2009 09:36

Beginning processing for Domain "3cc6A01"

Insertion by auto on 31 Mar 2009 23:10

Final ChopClose added based on similarity with "2etmA"