CATH Domain: 3cc1A02 XML data for domain: 3cc1A02

Molscript image for 3cc1A02
3cc1A02
PDB coordinates for domain 3cc1A02

PDB 3cc1, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.1180 Golgi alpha-mannosidase II Gene3D
2.60.40.1180.19
2.60.40.1180.19.1
2.60.40.1180.19.1.1
2.60.40.1180.19.1.1.1
2.60.40.1180.19.1.1.1.1

[top]
Segment boundaries for domain 3cc1A02

Chopping figure for domain 3cc1A02
DomainStart PDB ResidueStop PDB Residue
3cc1A01 0 344
3cc1A02 345 432

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 2.60.40.1180.19.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ea9C04 84.47 Bacillus sp.Cyclomaltodextrinase 2.60.40.1180 81 8 90 2.24 2.48
1uokA03 83.93 Bacillus cereusOligo-1,6-glucosidase 2.60.40.1180 78 11 85 2.99 3.49
1wzlA04 83.90 Neopullulanase 2Thermoactinomyces vulgaris 2.60.40.1180 83 12 91 2.83 3.09
1ua7A02 79.10 Starch and sucrose metabolismBacillus subtilisAlpha-amylaseAlpha-amylase [EC:3.2.1.1]Metabolic pathways 2.60.40.1180 78 8 89 4.07 4.56
1bf2A03 77.10 Pseudomonas amyloderamosaIsoamylase 2.60.40.1180 114 10 68 3.22 4.71
1lwjA03 76.29 4-alpha-glucanotransferase [EC:2.4.1.25]Thermotoga maritimaStarch and sucrose metabolism4-alpha-glucanotransferaseMetabolic pathways 2.60.40.1180 50 12 58 2.41 4.13
1iv8A05 75.06 Sulfolobus acidocaldariusGlycosyltrehalose-producing enzyme 2.60.40.1180 66 9 78 3.75 4.77
2qziA00 74.23 Streptococcus thermophilus LMG 18311Putative uncharacterized protein 3.40.1720.10 96 9 63 2.92 4.60
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3cc1A02
LNRFVYREEDKVAWAANGRNGEAYVALFNLHDQQKTLQFRLDVGIETVQLFNVWDRSFLQSLAPSESFQIELKPHQSLKL
SPDR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cc1A02
LNRFVYREEDKVAWAANGRNGEAYVALFNLHDQQKTLQFRLDXVGIXETVQLFNVWDRSFLQSLAPSESFQIELKPHQSX
XLKLSPDR
BLAST against CATH

[top]
Domain History Events (60)

Domain assigned by cuff on 30 Mar 2009 14:26

same superfamily

Domain assignment manual match h by cuff on 30 Mar 2009 14:25

homology match

Homcheck allotment by cuff on 30 Mar 2009 14:24

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 30 Mar 2009 14:24

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 18:42

Domain "3cc1A02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 18:42

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cc1A02

Flow stage update by auto on 19 Mar 2009 15:55

Retrieved PRC_PFAMCATH results for job ID SID8493878225598880 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 15:54

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 3cc1A02

Update comment by auto on 07 Mar 2009 09:50

PRC_PFAMCATH job SID8493878225598880 is not yet finished.

Flow stage update by auto on 07 Mar 2009 09:36

The entry "3cc1A02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 07 Mar 2009 09:36

The entry "3cc1A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Mar 2009 09:11

Retrieved SSAP results for job ID SID7348571736118024 and results inserted.

Domain scan ssap cath by auto on 07 Mar 2009 09:02

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2594 results for 3cc1A02

Update comment by auto on 04 Mar 2009 09:20

SSAP job SID7348571736118024 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:02

The entry "3cc1A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:02

The entry "3cc1A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 07:58

Retrieved PRC results for job ID SID5019638515469939 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 07:57

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 9 results for 3cc1A02

Flow stage update by auto on 04 Mar 2009 06:19

The entry "3cc1A02" has been submitted to the PRC webservice.

Prc cath submit by auto on 04 Mar 2009 06:19

The entry "3cc1A02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:07

Retrieved HMM(SAM) results for job ID SID2183110171343008 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:06

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 3cc1A02

Update comment by auto on 04 Mar 2009 01:15

HMM(SAM) job SID2183110171343008 is not yet finished.

Flow stage update by auto on 03 Mar 2009 23:48

The entry "3cc1A02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Mar 2009 23:48

The entry "3cc1A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:06

Unable to retrieve "3cc1A02" HMM(SAM) results for job "SID4533926151265252"

Update comment by auto on 19 Feb 2009 08:41

HMM(SAM) job SID4533926151265252 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:15

The entry "3cc1A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:15

The entry "3cc1A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:23

Unable to retrieve "3cc1A02" HMM(SAM) results for job "SID8124748170087120"

Update comment by auto on 22 Jan 2009 17:51

HMM(SAM) job SID8124748170087120 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:35

The entry "3cc1A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:35

The entry "3cc1A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:08

Unable to retrieve "3cc1A02" HMM(SAM) results for job "SID6092507990056384"

Update comment by auto on 03 Dec 2008 11:08

HMM(SAM) job SID6092507990056384 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 10:57

The entry "3cc1A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:57

The entry "3cc1A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:05

Retrieved "3cc1A02" CATHEDRAL results for job ID SID3751816443945848 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 10:04

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 219 results for 3cc1A02

Update comment by auto on 03 Dec 2008 01:00

"3cc1A02" CATHEDRAL job SID3751816443945848 is not yet finished.

Cathedral cath submit by auto on 03 Dec 2008 00:25

The entry "3cc1A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:25

The entry "3cc1A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:51

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cc1A02.scanlist" for "3cc1A02"

Write scan list by auto on 02 Dec 2008 23:51

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cc1A02.scanlist" for domain "3cc1A02"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:28

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:31

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 11:55

Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Dec 2008 11:24

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Dec 2008 11:07

No in_process hits for Domain "3cc1A02" ready to be processed

Flow stage update by auto on 01 Dec 2008 11:07

NW result present for Domain "3cc1A02"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3cc1A02"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3cc1A02"

Insertion by cuff on 27 Nov 2008 16:55

nice chopping