Domain assigned by cuff on 13 Oct 2008 15:33
same homology
CATH Domain: 3cbtA01
3cbtA01
PDB 3cbt, Chain A, Domain 1
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|3cbtA01 GHWAPGSHILWRYRENGGPHVHIARPVTVVRDDADLLAVWLAPGTECVKPVLADGTPVHLEPLATRYTKPRTVQRDQWFG TGVLKLARPGEAWSVWLFWDPGWRFKNWYVNLERPLTRWEGGVDSEDHFLDISVHPDRTWHWRDEDEFAQALRDGLDPAS AGRVRRAGRSAVAEIRAWGSPFADGWEHWRPDPA
Domain History Events (46)
Domain assignment manual match h by yan on 11 Aug 2008 14:31
good scores and superposition, predicted protein from a fosfomycin biosynthesis gene cluster in Streptomyces wedmorensis according to pfam, 17% sequence identity.
Homcheck review by yan on 11 Aug 2008 14:31
good scores and superposition, predicted protein from a fosfomycin biosynthesis gene cluster in Streptomyces wedmorensis according to pfam, 17% sequence identity.
Flow stage update by yan on 11 Aug 2008 14:31
good scores and superposition, predicted protein from a fosfomycin biosynthesis gene cluster in Streptomyces wedmorensis according to pfam, 17% sequence identity.
Homcheck allotment by yan on 11 Aug 2008 14:25
User 'yan' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by yan on 11 Aug 2008 14:25
User 'yan' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 10 Aug 2008 15:43
Domain "3cbtA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 10 Aug 2008 15:40
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cbtA01
Flow stage update by auto on 10 Aug 2008 15:34
Retrieved PRC_PFAMCATH results for job ID SID2227818386221728 and results inserted.
Domain scan prc pfamcath by auto on 10 Aug 2008 15:34
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 3cbtA01
Update comment by auto on 09 Aug 2008 07:08
PRC_PFAMCATH job SID2227818386221728 is not yet finished.
Prc pfamcath submit by auto on 09 Aug 2008 07:08
The entry "3cbtA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 09 Aug 2008 07:08
The entry "3cbtA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 09 Aug 2008 07:05
Retrieved SSAP results for job ID SID5808379891332352 and results inserted.
Domain scan ssap cath by auto on 09 Aug 2008 07:04
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 191 results for 3cbtA01
Update comment by auto on 07 Aug 2008 11:47
SSAP job SID5808379891332352 is not yet finished.
Ssap cath submit by auto on 07 Aug 2008 11:46
The entry "3cbtA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 07 Aug 2008 11:46
The entry "3cbtA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 07 Aug 2008 11:45
Retrieved PRC results for job ID SID5318434310545568 and inserted them into the database.
Domain scan prc cath by auto on 07 Aug 2008 11:44
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 3cbtA01
Update comment by auto on 07 Aug 2008 08:57
PRC job SID5318434310545568 is not yet finished.
Prc cath submit by auto on 07 Aug 2008 08:55
The entry "3cbtA01" has been submitted to the PRC webservice.
Flow stage update by auto on 07 Aug 2008 08:55
The entry "3cbtA01" has been submitted to the PRC webservice.
Flow stage update by auto on 07 Aug 2008 08:50
Retrieved HMM(SAM) results for job ID SID9566618243731864 and inserted them into the database.
Domain scan sam cath by auto on 07 Aug 2008 08:50
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 3cbtA01
Update comment by auto on 07 Aug 2008 03:55
HMM(SAM) job SID9566618243731864 is not yet finished.
Flow stage update by auto on 07 Aug 2008 03:52
The entry "3cbtA01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 07 Aug 2008 03:52
The entry "3cbtA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 07 Aug 2008 00:17
Unable to retrieve "3cbtA01" HMM(SAM) results for job "SID0250881609279764"
Update comment by auto on 06 Aug 2008 18:42
HMM(SAM) job SID0250881609279764 is not yet finished.
Flow stage update by auto on 06 Aug 2008 18:41
The entry "3cbtA01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 06 Aug 2008 18:41
The entry "3cbtA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 06 Aug 2008 18:35
Retrieved "3cbtA01" CATHEDRAL results for job ID SID5807910492920000 and inserted them into the database.
Domain scan cathedral cath by auto on 06 Aug 2008 18:34
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 601 results for 3cbtA01
Update comment by auto on 06 Aug 2008 16:06
"3cbtA01" CATHEDRAL job SID5807910492920000 is not yet finished.
Cathedral cath submit by auto on 06 Aug 2008 15:55
The entry "3cbtA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 06 Aug 2008 15:55
The entry "3cbtA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 06 Aug 2008 11:28
ScanList with 11809 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cbtA01.scanlist" for "3cbtA01"
Write scan list by auto on 06 Aug 2008 11:27
Writing ScanList containing 11809 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cbtA01.scanlist" for domain "3cbtA01"
Update comment by auto on 06 Aug 2008 08:18
Waiting for 42 new domains (example : 3czvB00) to be processed so that they can be scanned against too.
Flow stage update by auto on 06 Aug 2008 03:33
No satisfactory AssignClose result found.
Flow stage update by auto on 06 Aug 2008 02:48
No in_process hits for Domain "3cbtA01" ready to be processed
Flow stage update by auto on 06 Aug 2008 02:48
NW result present for Domain "3cbtA01"
Flow stage update by auto on 05 Aug 2008 11:17
All required files are present for Domain "3cbtA01"
Flow stage update by auto on 04 Aug 2008 19:17
Beginning processing for Domain "3cbtA01"
Insertion by auto on 04 Aug 2008 17:12
Final ChopClose added based on similarity with "3bxtA"
