Domain assigned by auto on 01 Dec 2008 08:56
Assigning to "2.80.10.50" based on similarity with "1hwmB02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3c9zA01 | 1 | 130 |
| 3c9zA02 | 131 | 255 |
There are 27 matching structural neighberhood comparisons for CATH ID 2.80.10.50.9.1.1.1.1 (SIMAX score < 5)
>pdb|3c9zA02 PIVASIVGYKEMCLQSNGENNGVWMEDCEATSLQQQWALYGDRTIRVNSTRGLCVTTNGYNSKDLIIILKCQGLPSQRWF FNSDGAIVNPKSRLVMDVRASNVSLREIIIFPATGNPNQQWVTQV
Assigning to "2.80.10.50" based on similarity with "1hwmB02"
No in_process hits for Domain "3c9zA02" ready to be processed
NW result present for Domain "3c9zA02"
All required files are present for Domain "3c9zA02"
Beginning processing for Domain "3c9zA02"
Final ChopClose added based on similarity with "1hwmB"