Domain assigned by auto on 23 Mar 2008 06:29
Assigning to "3.30.1330.10" based on similarity with "3c9rB01"
CATH Domain: 3c9uB01
3c9uB01
PDB 3c9u, Chain B, Domain 1
Segment boundaries for domain 3c9uB01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3c9uB01 | -5 | 140 |
| 3c9uB02 | 141 | 306 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|3c9uB01 FQGSFTMRLKELGEFGLIDLIKKTLESKVIGDDTAPVEYCSKKLLLTTDVLNEGVHFLRSYIPEAVGWKAISVNVSDVIA NGGLPKWALISLNLPEDLEVSYVERFYIGVKRACEFYKCEVVGGNISKSEKIGISVFLVGETERFV
Domain History Events (10)
Flow stage update by auto on 23 Mar 2008 06:28
No in_process hits for Domain "3c9uB01" ready to be processed
Update comment by auto on 23 Mar 2008 06:15
Domain "3c9uB01" hits Domain "3c9rB01" (100% over 99.3150684931507%) which is currently in process
Update comment by auto on 23 Mar 2008 06:05
Domain "3c9uB01" hits Domain "3c9rA01" (100% over 98.6301369863014%) which is currently in process
Update comment by auto on 23 Mar 2008 05:46
Domain "3c9uB01" hits Domain "3c9sA01" (100% over 98.6301369863014%) which is currently in process
Flow stage update by auto on 23 Mar 2008 05:18
Domain "3c9uB01" hits Domain "3c9sA01" (100% over 98.6301369863014%) which is currently in process
Flow stage update by auto on 23 Mar 2008 05:18
NW result present for Domain "3c9uB01"
Flow stage update by auto on 22 Mar 2008 11:05
All required files are present for Domain "3c9uB01"
Flow stage update by auto on 21 Mar 2008 18:01
Beginning processing for Domain "3c9uB01"
Insertion by auto on 21 Mar 2008 17:21
Final ChopClose added based on similarity with "3c9sA"
