CATH Domain: 3c9uA02 XML data for domain: 3c9uA02

Molscript image for 3c9uA02
3c9uA02
PDB coordinates for domain 3c9uA02

PDB 3c9u, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.650 Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2
3.90.650.10 Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 Gene3D
3.90.650.10.1
3.90.650.10.1.1
3.90.650.10.1.1.1
3.90.650.10.1.1.1.1
3.90.650.10.1.1.1.1.1

[top]
Segment boundaries for domain 3c9uA02

Chopping figure for domain 3c9uA02
DomainStart PDB ResidueStop PDB Residue
3c9uA01 -1 140
3c9uA02 141 306

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.90.650.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2z01A02 78.40 Phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]Geobacillus kaustophilusPurine metabolismMetabolic pathwaysPhosphoribosylformylglycinamidine cyclo-ligase 3.90.650.10 175 14 88 4.04 4.59
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3c9uA02
GRDGARLGDSVFVSGTLGDSRAGLELLLMEKEEYEPFELALIQRHLRPTARIDYVKHIQKYANASMDISDGLVADANHLA
QRSGVKIEILSEKLPLSNELKMYCEKYGKNPIEYALFGGEDYQLLFTHPKERWNPFLDMTEIGRVEEGEGVFVDGKKVEP
KGWKHF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c9uA02
GRDGARLGDSVFVSGTLGDSRAGLELLLMEKEEYEPFELALIQRHLRPTARIDYVKHIQKYANASMDISDGLVADANHLA
QRSGVKIEILSEKLPLSNELKMYCEKYGKNPIEYALFGGEDYQLLFTHPKERWNPFLDMTEIGRVEEGEGVFVDGKKVEP
KGWKHF
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 23 Mar 2008 07:10

Assigning to "3.90.650.10" based on similarity with "3c9rA02"

Flow stage update by auto on 23 Mar 2008 07:09

No in_process hits for Domain "3c9uA02" ready to be processed

Update comment by auto on 23 Mar 2008 06:57

Domain "3c9uA02" hits Domain "3c9tB02" (100% over 100%) which is currently in process

Update comment by auto on 23 Mar 2008 06:44

Domain "3c9uA02" hits Domain "3c9sB02" (100% over 100%) which is currently in process

Update comment by auto on 23 Mar 2008 06:28

Domain "3c9uA02" hits Domain "3c9rA02" (100% over 100%) which is currently in process

Update comment by auto on 23 Mar 2008 06:15

Domain "3c9uA02" hits Domain "3c9uB02" (100% over 100%) which is currently in process

Update comment by auto on 23 Mar 2008 06:05

Domain "3c9uA02" hits Domain "3c9rB02" (100% over 100%) which is currently in process

Update comment by auto on 23 Mar 2008 05:46

Domain "3c9uA02" hits Domain "3c9sA02" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Mar 2008 05:18

Domain "3c9uA02" hits Domain "3c9sA02" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Mar 2008 05:18

NW result present for Domain "3c9uA02"

Flow stage update by auto on 22 Mar 2008 11:05

All required files are present for Domain "3c9uA02"

Flow stage update by auto on 21 Mar 2008 18:01

Beginning processing for Domain "3c9uA02"

Insertion by auto on 21 Mar 2008 17:17

Final ChopClose added based on similarity with "3c9sA"