Domain assigned by auto on 28 Apr 2009 11:27
Assigning to "2.160.10.10" based on similarity with "3c8vA03"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3c8vC01 | 0 | 41 |
| 3c8vC02 | 42 | 228 |
| 3c8vC02 | 395 | 411 |
| 3c8vC02 | 431 | 475 |
| 3c8vC03 | 229 | 394 |
| 3c8vC04 | 412 | 430 |
There are 3 matching structural neighberhood comparisons for CATH ID 2.160.10.10.10.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1m8nB00 | 81.31 | 2.160.10.20 | 119 | 11 | 69 | 2.08 | 3.00 | |
![]() |
1ssqA02 | 78.40 | 2.160.10.10 | 103 | 11 | 55 | 2.14 | 3.84 | |
![]() |
1ssqD02 | 78.31 | 2.160.10.10 | 119 | 10 | 57 | 2.15 | 3.77 |
>pdb|3c8vC03 GVLEFVEVRQEDFEEVFASGHSASGASVSGYAVIKGDTVIGENVLVSQRAYLDNAWGKGSNAQENCYIINSRLERNCVTA HGGKIINAHLGDIFTGFNSFLQGSESSPLKIGDGCVVPHTIIDLEEPLEIPAGHLVWGYIRNKADLAAHSISFEEF
Assigning to "2.160.10.10" based on similarity with "3c8vA03"
No in_process hits for Domain "3c8vC03" ready to be processed
NW result present for Domain "3c8vC03"
All required files are present for Domain "3c8vC03"
Beginning processing for Domain "3c8vC03"
nice chopping