CATH Domain: 3c8vA02 XML data for domain: 3c8vA02

Molscript image for 3c8vA02
3c8vA02
PDB coordinates for domain 3c8vA02

PDB 3c8v, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.160 3 Solenoid
2.160.10 UDP N-Acetylglucosamine Acyltransferase; domain 1
2.160.10.10 Hexapeptide repeat proteins Gene3D
2.160.10.10.15
2.160.10.10.15.1
2.160.10.10.15.1.1
2.160.10.10.15.1.1.1
2.160.10.10.15.1.1.1.1

[top]
Segment boundaries for domain 3c8vA02

Chopping figure for domain 3c8vA02
DomainStart PDB ResidueStop PDB Residue
3c8vA01 0 41
3c8vA02 42 228
3c8vA02 395 411
3c8vA02 431 475
3c8vA03 229 394
3c8vA04 412 430

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3c8vA02
FYAFYGLSADDPVHFHFKNSSLAGSYLLGRVNVLHSALYKSDIRGDELKRKGQHFVCDGKIPLHDDEVITIKDSFLNKTL
VHSNSHDPESPEEFTIRNTVAPYANIHGSLTEGSFIGSFATVDLSTIHNSVVRYFSYVQTGELVGKCVEPGQIWIKSGDE
LEFHYSFDKAILDKYISQEAGSCPTAKVDGEVTGRTFRGKGKNFTFNIIQPYQDGDPRGYPTILIQPNN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c8vA02
FYAFYGLSADDPVHFHFKNSSLAGSYLLGRVNVLHSALYKSDIRGDELKRKGQHFVCDGKXIPLHDDEVITIKDSFLNKT
LVHSNSHDPESPEEFTIRNTVAXPYANIHGSLTEGSFIGSFATVDLSTIHNSVVRYFSYVQTGELVGKCVEPGQIWIKSG
DELEFHYSFDKAILDKYISQEAGSCPTAKVDGEVTXGRXTFRGKGAFFDGSEGTGHAQKGKNFTFNIIQPYQDGDPRGXY
PTILIQPNNGS
BLAST against CATH

[top]
Domain History Events (62)

Domain assigned by cuff on 27 Mar 2009 16:53

homology match

Domain assignment manual match h by cuff on 27 Mar 2009 16:50

homology match

Homcheck allotment by cuff on 27 Mar 2009 16:48

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 27 Mar 2009 16:48

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 18:28

Domain "3c8vA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 18:28

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3c8vA02

Flow stage update by auto on 19 Mar 2009 15:36

Retrieved PRC_PFAMCATH results for job ID SID6282113023285504 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 15:35

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 3c8vA02

Update comment by auto on 07 Mar 2009 09:49

PRC_PFAMCATH job SID6282113023285504 is not yet finished.

Flow stage update by auto on 07 Mar 2009 09:34

The entry "3c8vA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 07 Mar 2009 09:34

The entry "3c8vA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Mar 2009 08:19

Retrieved SSAP results for job ID SID7103647645326528 and results inserted.

Domain scan ssap cath by auto on 07 Mar 2009 08:18

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 18 results for 3c8vA02

Update comment by auto on 04 Mar 2009 09:18

SSAP job SID7103647645326528 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:00

The entry "3c8vA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:00

The entry "3c8vA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 07:45

Retrieved PRC results for job ID SID4885791140156008 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 07:44

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 3c8vA02

Flow stage update by auto on 04 Mar 2009 06:15

The entry "3c8vA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 04 Mar 2009 06:15

The entry "3c8vA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 04:54

Retrieved HMM(SAM) results for job ID SID5992625601731168 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 04:54

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3c8vA02

Update comment by auto on 04 Mar 2009 01:13

HMM(SAM) job SID5992625601731168 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:45

The entry "3c8vA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:45

The entry "3c8vA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:04

Unable to retrieve "3c8vA02" HMM(SAM) results for job "SID1206819053321248"

Update comment by auto on 19 Feb 2009 08:40

HMM(SAM) job SID1206819053321248 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:12

The entry "3c8vA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:12

The entry "3c8vA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:22

Unable to retrieve "3c8vA02" HMM(SAM) results for job "SID4084529865005552"

Update comment by auto on 22 Jan 2009 17:50

HMM(SAM) job SID4084529865005552 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:32

The entry "3c8vA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:32

The entry "3c8vA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:06

Unable to retrieve "3c8vA02" HMM(SAM) results for job "SID9129058715603392"

Update comment by auto on 03 Dec 2008 11:06

HMM(SAM) job SID9129058715603392 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 10:55

The entry "3c8vA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:55

The entry "3c8vA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 09:25

Retrieved "3c8vA02" CATHEDRAL results for job ID SID9872811907624744 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 09:25

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 45 results for 3c8vA02

Update comment by auto on 03 Dec 2008 00:58

"3c8vA02" CATHEDRAL job SID9872811907624744 is not yet finished.

Cathedral cath submit by auto on 03 Dec 2008 00:22

The entry "3c8vA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:22

The entry "3c8vA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:47

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3c8vA02.scanlist" for "3c8vA02"

Write scan list by auto on 02 Dec 2008 23:47

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3c8vA02.scanlist" for domain "3c8vA02"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:28

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:31

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 11:55

Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 08:56

Waiting for 355 new domains (example : 3cawA02) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 06:13

Waiting for 387 new domains (example : 3c9fA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Dec 2008 06:13

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Dec 2008 05:39

No in_process hits for Domain "3c8vA02" ready to be processed

Flow stage update by auto on 01 Dec 2008 05:39

NW result present for Domain "3c8vA02"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3c8vA02"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3c8vA02"

Insertion by cuff on 27 Nov 2008 17:22

nice chopping