CATH Domain: 3c8mA02 XML data for domain: 3c8mA02

Molscript image for 3c8mA02
3c8mA02
PDB coordinates for domain 3c8mA02

PDB 3c8m, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.360 Dihydrodipicolinate Reductase; domain 2
3.30.360.10 Dihydrodipicolinate Reductase; domain 2 Gene3D
3.30.360.10.9
3.30.360.10.9.1
3.30.360.10.9.1.1
3.30.360.10.9.1.1.1
3.30.360.10.9.1.1.1.1

[top]
Segment boundaries for domain 3c8mA02

Chopping figure for domain 3c8mA02
DomainStart PDB ResidueStop PDB Residue
3c8mA01 2 150
3c8mA01 306 324
3c8mA02 151 305

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.360.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ebfA02 81.38 NucleusHomoserine dehydrogenase [EC:1.1.1.3]Glycine, serine and threonine metabolismLysine biosynthesisMetabolic pathways 3.30.360.10 175 21 77 2.51 3.25
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3c8mA02
PLFSFIDYSVLPSRIKKFRGIVSLTINYFIRELANKREFDDVLSEATKLGIVEKNYKDDLTGLDAARKSVILCNHLYGSS
YRLSDVFYEGILQDRSFGKNERLVTETGIVNGKPSAESRIKSLDSNDYLLTLGKGSLGYQLQTDTNGTLNVSDL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c8mA02
PLFSFIDYSVLPSRIKKFRGIVSLTINYFIRELANKREFDDVLSEATKLGIVEKNYKDDLTGLDAARKSVILCNHLYGSS
YRLSDVFYEGILDQDRSFGKNERLVTETGIVNGKPSAESRIKSLDSNDYLLTLGKGSLGYQLQTDTNGTLNVSDL
BLAST against CATH

[top]
Domain History Events (62)

Domain assigned by cuff on 27 Mar 2009 16:40

same superfamily

Domain assignment manual match h by cuff on 27 Mar 2009 16:39

same superfamily

Homcheck allotment by cuff on 27 Mar 2009 16:37

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 27 Mar 2009 16:37

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 18:24

Domain "3c8mA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 18:23

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3c8mA02

Flow stage update by auto on 19 Mar 2009 15:31

Retrieved PRC_PFAMCATH results for job ID SID7442584566684880 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 15:30

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3 results for 3c8mA02

Update comment by auto on 07 Mar 2009 01:40

PRC_PFAMCATH job SID7442584566684880 is not yet finished.

Prc pfamcath submit by auto on 07 Mar 2009 01:27

The entry "3c8mA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Mar 2009 01:27

The entry "3c8mA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Mar 2009 01:08

Retrieved SSAP results for job ID SID9944633068020704 and results inserted.

Domain scan ssap cath by auto on 07 Mar 2009 01:06

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 342 results for 3c8mA02

Update comment by auto on 04 Mar 2009 09:18

SSAP job SID9944633068020704 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 08:59

The entry "3c8mA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:59

The entry "3c8mA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 07:41

Retrieved PRC results for job ID SID0626013118545436 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 07:40

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 3c8mA02

Flow stage update by auto on 04 Mar 2009 06:14

The entry "3c8mA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 04 Mar 2009 06:14

The entry "3c8mA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 04:51

Retrieved HMM(SAM) results for job ID SID6362735360517248 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 04:50

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 3c8mA02

Update comment by auto on 04 Mar 2009 01:12

HMM(SAM) job SID6362735360517248 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:44

The entry "3c8mA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:44

The entry "3c8mA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:04

Unable to retrieve "3c8mA02" HMM(SAM) results for job "SID4742125742368704"

Update comment by auto on 19 Feb 2009 08:40

HMM(SAM) job SID4742125742368704 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:12

The entry "3c8mA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:12

The entry "3c8mA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:21

Unable to retrieve "3c8mA02" HMM(SAM) results for job "SID2265367598140832"

Update comment by auto on 22 Jan 2009 17:50

HMM(SAM) job SID2265367598140832 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:32

The entry "3c8mA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:32

The entry "3c8mA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:06

Unable to retrieve "3c8mA02" HMM(SAM) results for job "SID3288060226328596"

Update comment by auto on 03 Dec 2008 11:06

HMM(SAM) job SID3288060226328596 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 10:55

The entry "3c8mA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:55

The entry "3c8mA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 09:24

Retrieved "3c8mA02" CATHEDRAL results for job ID SID5269881647803640 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 09:21

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 543 results for 3c8mA02

Update comment by auto on 03 Dec 2008 00:57

"3c8mA02" CATHEDRAL job SID5269881647803640 is not yet finished.

Cathedral cath submit by auto on 03 Dec 2008 00:22

The entry "3c8mA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:22

The entry "3c8mA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:46

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3c8mA02.scanlist" for "3c8mA02"

Write scan list by auto on 02 Dec 2008 23:46

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3c8mA02.scanlist" for domain "3c8mA02"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:28

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:31

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 11:55

Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 08:56

Waiting for 355 new domains (example : 3cawA02) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 06:13

Waiting for 387 new domains (example : 3c9fA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Dec 2008 06:13

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Dec 2008 05:39

No in_process hits for Domain "3c8mA02" ready to be processed

Flow stage update by auto on 01 Dec 2008 05:39

NW result present for Domain "3c8mA02"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3c8mA02"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3c8mA02"

Insertion by cuff on 27 Nov 2008 16:43

nice chopping