CATH Domain: 3c8lB00 XML data for domain: 3c8lB00

Molscript image for 3c8lB00
3c8lB00
PDB coordinates for domain 3c8lB00

PDB 3c8l, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1330 60s Ribosomal Protein L30; Chain: A;
3.30.1330.20 Gene3D
3.30.1330.20.1
3.30.1330.20.1.1
3.30.1330.20.1.1.1
3.30.1330.20.1.1.1.1
3.30.1330.20.1.1.1.1.1

[top]
Segment boundaries for domain 3c8lB00

Chopping figure for domain 3c8lB00
DomainStart PDB ResidueStop PDB Residue
3c8lB00 0 118

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.1330.20.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rq2B02 78.96 Cell division protein FtsZCell division protein ftsZMycobacterium tuberculosis 3.30.1330.20 96 10 70 3.41 4.85
2vapA02 78.28 Cell division protein FtsZMethanocaldococcus jannaschiiCell division protein ftsZ homolog 1 3.30.1330.20 105 12 68 2.77 4.04
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3c8lB00
GARKRLIIEGGIDQHGQEPTIAASRAVRNAIAHNALPGVWEVAGLSHPNEIIEVQVAVPYPEQVREEEVLAVLPFGRKTL
TVESGGIVQGRAIPELNDKNDELIAIAAVTVLI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c8lB00
GXARKRLIIEXGXGIDQHGQEPTIAASRAVRNAIAHNALPGVWEVAGLSHPNEXIIEVQVAVPYPEQVREEEVLAVLPFG
RKTLTVESGGXIVQGRAIPELNDKNDEXLIAIAAVTVLIENE
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 27 Mar 2009 17:29

Assigning to "3.30.1330.20" based on similarity with "3c8lA00"

Flow stage update by auto on 27 Mar 2009 17:12

No in_process hits for Domain "3c8lB00" ready to be processed

Update comment by auto on 01 Dec 2008 05:44

Domain "3c8lB00" hits Domain "3c8lA00" (95.0819672131148% over 100%) which is currently in process

Flow stage update by auto on 01 Dec 2008 05:39

Domain "3c8lB00" hits Domain "3c8lA00" (95.0819672131148% over 100%) which is currently in process

Flow stage update by auto on 01 Dec 2008 05:39

NW result present for Domain "3c8lB00"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3c8lB00"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3c8lB00"

Insertion by auto on 27 Nov 2008 17:19

Final ChopClose added based on similarity with "3c8lA"