CATH Domain: 3c7iA00 XML data for domain: 3c7iA00

Molscript image for 3c7iA00
3c7iA00
PDB coordinates for domain 3c7iA00

PDB 3c7i, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.5
3.30.505.10.5.1
3.30.505.10.5.1.1
3.30.505.10.5.1.1.1
3.30.505.10.5.1.1.1.1

[top]
Segment boundaries for domain 3c7iA00

Chopping figure for domain 3c7iA00
DomainStart PDB ResidueStop PDB Residue
3c7iA00 55 155

Structural Neighbourhood (18 entries)

There are 18 matching structural neighberhood comparisons for CATH ID 3.30.505.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 18 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1r1pB00 93.04 GRB2-related adaptor protein 2Mus musculusT cell receptor signaling pathwayProtein binding 3.30.505.10 100 51 94 1.07 1.14
1opkA02 90.96 Protein domain specific bindingNucleusManganese ion bindingPeptidyl-tyrosine phosphorylationMus musculus 3.30.505.10 102 30 89 1.76 1.97
2shpA02 89.57 Tyrosine-protein phosphatase non-receptor type 11Homo sapiens 3.30.505.10 101 30 92 1.68 1.82
2oq1A03 89.38 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 99 29 94 2.37 2.52
2crhA01 89.17 Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis 3.30.505.10 102 27 94 2.62 2.78
2oq1A01 88.54 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 108 26 88 2.57 2.89
1i3zA00 88.23 Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding 3.30.505.10 102 28 92 2.57 2.79
1qadA00 87.85 Jak-STAT signaling pathwayAldosterone-regulated sodium reabsorptionNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathway 3.30.505.10 104 26 90 2.29 2.53
3bkbA01 87.58 Tyrosine-protein kinase Fes/FpsHomo sapiensCell proliferationMulticellular organismal development 3.30.505.10 93 27 84 1.83 2.17
1ayaA00 87.44 Hormone-mediated signaling pathwayRegulation of multicellular organism growthNerve growth factor receptor signaling pathwayTriglyceride metabolic processNegative regulation of insulin secretion 3.30.505.10 101 32 96 2.27 2.36
2dm0A01 87.26 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 25 88 1.80 2.04
2iugA00 86.73 ErbB-3 class receptor bindingInsulin-like growth factor receptor signaling pathwayInsulin receptor signaling pathwayGrowth hormone receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 110 24 90 2.89 3.21
1milA00 86.51 Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 104 25 92 2.58 2.79
2kk6A00 85.33 CytoplasmFer (fps/fes related) tyrosine kinase [EC:2.7.10.2]Homo sapiensAdherens junctionTyrosine-protein kinase Fer 3.30.505.10 116 28 83 2.45 2.93
1ju5A00 85.25 Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway 3.30.505.10 109 24 84 2.20 2.61
3buxB03 84.47 Jak-STAT signaling pathwayPathways in cancerT cell receptor signaling pathwayErbB signaling pathwayChronic myeloid leukemia 3.30.505.10 86 11 78 2.81 3.59
2vifA01 84.18 CytoplasmJAK-STAT cascadeDefense responseSuppressor of cytokine signaling 6Suppressor of cytokine signaling 6 3.30.505.10 126 21 78 2.65 3.37
2pldA00 83.72 Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway 3.30.505.10 105 25 94 3.68 3.90
[1]
Displaying entries 1 to 18 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3c7iA00
MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDY
HRSTSVSRNQQIFLRDIEQVP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c7iA00
IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV
DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQHHHHHH
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 26 Aug 2008 20:27

Assigning to "3.30.505.10" based on similarity with "2huwA00"

Flow stage update by auto on 26 Aug 2008 20:08

No in_process hits for Domain "3c7iA00" ready to be processed

Flow stage update by auto on 26 Aug 2008 20:08

NW result present for Domain "3c7iA00"

Flow stage update by auto on 26 Aug 2008 08:10

All required files are present for Domain "3c7iA00"

Flow stage update by auto on 25 Aug 2008 11:31

Beginning processing for Domain "3c7iA00"

Insertion by auto on 25 Aug 2008 11:10

Final ChopClose added based on similarity with "2huwA"