Domain assigned by cuff on 20 Apr 2009 15:17
homology match
CATH Domain: 3c6vA00
3c6vA00
PDB 3c6v, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|3c6vA00 FQGPRWLIQHSPNTLTPEEKSHLAQQITQAYVGFGLPAFYVQVHFIEQPAGTSFIGGEQHPNFVALTIYHLARTTSDEQR QGFLKRIDAFLTPFEPKGIDWEYFVTEAPRDLWKINGLAPPAAGSEEEKVWVRENRPVRF
Domain History Events (63)
Domain assignment manual match h by cuff on 20 Apr 2009 15:16
same superfamily
Homcheck allotment by cuff on 27 Mar 2009 12:48
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 27 Mar 2009 12:48
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 19 Mar 2009 18:20
Domain "3c6vA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 19 Mar 2009 18:19
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3c6vA00
Flow stage update by auto on 19 Mar 2009 15:24
Retrieved PRC_PFAMCATH results for job ID SID1756564604119744 and results inserted.
Domain scan prc pfamcath by auto on 19 Mar 2009 15:24
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 9 results for 3c6vA00
Update comment by auto on 06 Mar 2009 19:02
PRC_PFAMCATH job SID1756564604119744 is not yet finished.
Prc pfamcath submit by auto on 06 Mar 2009 18:53
The entry "3c6vA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 06 Mar 2009 18:53
The entry "3c6vA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 06 Mar 2009 18:39
Retrieved SSAP results for job ID SID3192077393156016 and results inserted.
Domain scan ssap cath by auto on 06 Mar 2009 18:35
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2151 results for 3c6vA00
Update comment by auto on 04 Mar 2009 09:17
SSAP job SID3192077393156016 is not yet finished.
Ssap cath submit by auto on 04 Mar 2009 08:59
The entry "3c6vA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 04 Mar 2009 08:59
The entry "3c6vA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 04 Mar 2009 07:37
Retrieved PRC results for job ID SID6272256228099845 and inserted them into the database.
Domain scan prc cath by auto on 04 Mar 2009 07:36
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 5 results for 3c6vA00
Flow stage update by auto on 04 Mar 2009 06:13
The entry "3c6vA00" has been submitted to the PRC webservice.
Prc cath submit by auto on 04 Mar 2009 06:13
The entry "3c6vA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Mar 2009 04:47
Retrieved HMM(SAM) results for job ID SID0109816359520336 and inserted them into the database.
Domain scan sam cath by auto on 04 Mar 2009 04:47
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3c6vA00
Update comment by auto on 04 Mar 2009 01:12
HMM(SAM) job SID0109816359520336 is not yet finished.
Sam cath submit by auto on 03 Mar 2009 23:43
The entry "3c6vA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Mar 2009 23:43
The entry "3c6vA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 16:03
Unable to retrieve "3c6vA00" HMM(SAM) results for job "SID2056607150091288"
Update comment by auto on 19 Feb 2009 08:39
HMM(SAM) job SID2056607150091288 is not yet finished.
Sam cath submit by auto on 19 Feb 2009 08:11
The entry "3c6vA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 08:11
The entry "3c6vA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 27 Jan 2009 12:21
Unable to retrieve "3c6vA00" HMM(SAM) results for job "SID1367346939405680"
Update comment by auto on 22 Jan 2009 17:49
HMM(SAM) job SID1367346939405680 is not yet finished.
Flow stage update by auto on 22 Jan 2009 17:31
The entry "3c6vA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 22 Jan 2009 17:31
The entry "3c6vA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Dec 2008 15:05
Unable to retrieve "3c6vA00" HMM(SAM) results for job "SID7414816906012613"
Update comment by auto on 03 Dec 2008 11:06
HMM(SAM) job SID7414816906012613 is not yet finished.
Sam cath submit by auto on 03 Dec 2008 10:54
The entry "3c6vA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Dec 2008 10:54
The entry "3c6vA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Dec 2008 09:10
Retrieved "3c6vA00" CATHEDRAL results for job ID SID1147474992312623 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Dec 2008 09:08
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 237 results for 3c6vA00
Update comment by auto on 03 Dec 2008 00:57
"3c6vA00" CATHEDRAL job SID1147474992312623 is not yet finished.
Cathedral cath submit by auto on 03 Dec 2008 00:20
The entry "3c6vA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Dec 2008 00:20
The entry "3c6vA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 02 Dec 2008 23:45
ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3c6vA00.scanlist" for "3c6vA00"
Write scan list by auto on 02 Dec 2008 23:45
Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3c6vA00.scanlist" for domain "3c6vA00"
Update comment by auto on 02 Dec 2008 21:06
Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 17:28
Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 15:14
Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 11:26
Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 10:46
Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 23:28
Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 21:05
Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 18:09
Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 14:31
Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 11:55
Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 08:56
Waiting for 355 new domains (example : 3cawA02) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 06:13
Waiting for 387 new domains (example : 3c9fA01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 03:59
Waiting for 407 new domains (example : 3c8cA02) to be processed so that they can be scanned against too.
Flow stage update by auto on 01 Dec 2008 03:58
No satisfactory AssignClose result found.
Flow stage update by auto on 01 Dec 2008 02:56
No in_process hits for Domain "3c6vA00" ready to be processed
Flow stage update by auto on 01 Dec 2008 02:56
NW result present for Domain "3c6vA00"
Flow stage update by auto on 28 Nov 2008 11:14
All required files are present for Domain "3c6vA00"
Flow stage update by auto on 27 Nov 2008 20:08
Beginning processing for Domain "3c6vA00"
Insertion by cuff on 27 Nov 2008 16:30
nice chopping
