Domain assigned by cuff on 27 Mar 2009 11:50
homology match
CATH Domain: 3c5mA00
3c5mA00
PDB 3c5m, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|3c5mA00 AKGDVITLNFETFVDSDTQVKVTRLTPTDIICHRNYFYQKCFTQDGKKLLFAGDFDGNRNYYLLNLETQQAVQLTEGKGD NTFGGFISTDERAFFYVKNELNLKVDLETLEEQVIYTVDEEWKGYGTWVANSDCTKLVGIEILKRDWQPLTSWEKFAEFY HTNPTCRLIKVDIETGELEVIHQDTAWLGHPIYRPFDDSTVGFCHEGPHDLVDARWLVNEDGSNVRKIKEHAEGESCTHE FWIPDGSAAYVSYFKGQTDRVIYKANPETLENEEVVPPCSHLSNFDGSLVGDGCDANIENDPFLYVLNTKAKSAQKLCKH STSWDVLDGDRQITHPHPSFTPNDDGVLFTSDFEGVPAIYIADVPESYK
Domain COMBS Sequence
>pdb|3c5mA00 XAKGDVITLNFETFVDSDTQVKVTRLTPTDIICHRNYFYQKCFTQDGKKLLFAGDFDGNRNYYLLNLETQQAVQLTEGKG DNTFGGFISTDERAFFYVKNELNLXKVDLETLEEQVIYTVDEEWKGYGTWVANSDCTKLVGIEILKRDWQPLTSWEKFAE FYHTNPTCRLIKVDIETGELEVIHQDTAWLGHPIYRPFDDSTVGFCHEGPHDLVDARXWLVNEDGSNVRKIKEHAEGESC THEFWIPDGSAXAYVSYFKGQTDRVIYKANPETLENEEVXVXPPCSHLXSNFDGSLXVGDGCDAPVDVADADSYNIENDP FLYVLNTKAKSAQKLCKHSTSWDVLDGDRQITHPHPSFTPNDDGVLFTSDFEGVPAIYIADVPESYKHLEHHHHHH
Domain History Events (64)
Domain assignment manual match h by cuff on 27 Mar 2009 11:49
same superfamily
Homcheck allotment by cuff on 27 Mar 2009 11:38
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 27 Mar 2009 11:38
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 19 Mar 2009 18:13
Domain "3c5mA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 19 Mar 2009 18:13
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3c5mA00
Flow stage update by auto on 19 Mar 2009 15:16
Retrieved PRC_PFAMCATH results for job ID SID8363207127792448 and results inserted.
Domain scan prc pfamcath by auto on 19 Mar 2009 15:15
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 169 results for 3c5mA00
Update comment by auto on 08 Mar 2009 10:10
PRC_PFAMCATH job SID8363207127792448 is not yet finished.
Flow stage update by auto on 08 Mar 2009 10:01
The entry "3c5mA00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 08 Mar 2009 10:01
The entry "3c5mA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Mar 2009 09:48
Retrieved SSAP results for job ID SID1488119514144224 and results inserted.
Domain scan ssap cath by auto on 08 Mar 2009 09:47
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 76 results for 3c5mA00
Update comment by auto on 04 Mar 2009 09:17
SSAP job SID1488119514144224 is not yet finished.
Flow stage update by auto on 04 Mar 2009 08:58
The entry "3c5mA00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 04 Mar 2009 08:58
The entry "3c5mA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 04 Mar 2009 07:31
Retrieved PRC results for job ID SID0612238606430428 and inserted them into the database.
Domain scan prc cath by auto on 04 Mar 2009 07:31
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 42 results for 3c5mA00
Prc cath submit by auto on 04 Mar 2009 06:12
The entry "3c5mA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Mar 2009 06:12
The entry "3c5mA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Mar 2009 04:42
Retrieved HMM(SAM) results for job ID SID3783851568875584 and inserted them into the database.
Domain scan sam cath by auto on 04 Mar 2009 04:42
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 10 results for 3c5mA00
Update comment by auto on 04 Mar 2009 01:11
HMM(SAM) job SID3783851568875584 is not yet finished.
Sam cath submit by auto on 03 Mar 2009 23:42
The entry "3c5mA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Mar 2009 23:42
The entry "3c5mA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 16:02
Unable to retrieve "3c5mA00" HMM(SAM) results for job "SID1816230542972352"
Update comment by auto on 19 Feb 2009 08:38
HMM(SAM) job SID1816230542972352 is not yet finished.
Flow stage update by auto on 19 Feb 2009 08:11
The entry "3c5mA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 19 Feb 2009 08:11
The entry "3c5mA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 27 Jan 2009 12:20
Unable to retrieve "3c5mA00" HMM(SAM) results for job "SID7911186369145568"
Update comment by auto on 22 Jan 2009 17:49
HMM(SAM) job SID7911186369145568 is not yet finished.
Sam cath submit by auto on 22 Jan 2009 17:31
The entry "3c5mA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 22 Jan 2009 17:31
The entry "3c5mA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Dec 2008 15:05
Unable to retrieve "3c5mA00" HMM(SAM) results for job "SID3048159952375920"
Update comment by auto on 03 Dec 2008 11:05
HMM(SAM) job SID3048159952375920 is not yet finished.
Sam cath submit by auto on 03 Dec 2008 10:53
The entry "3c5mA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Dec 2008 10:53
The entry "3c5mA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Dec 2008 06:10
Retrieved "3c5mA00" CATHEDRAL results for job ID SID1205678223259115 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Dec 2008 06:09
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 53 results for 3c5mA00
Update comment by auto on 03 Dec 2008 00:56
"3c5mA00" CATHEDRAL job SID1205678223259115 is not yet finished.
Flow stage update by auto on 03 Dec 2008 00:19
The entry "3c5mA00" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Dec 2008 00:19
The entry "3c5mA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 02 Dec 2008 23:44
ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3c5mA00.scanlist" for "3c5mA00"
Write scan list by auto on 02 Dec 2008 23:43
Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3c5mA00.scanlist" for domain "3c5mA00"
Update comment by auto on 02 Dec 2008 21:06
Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 17:27
Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 15:14
Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 11:26
Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 10:46
Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 23:28
Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 21:05
Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 18:09
Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 14:31
Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 11:55
Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 08:56
Waiting for 355 new domains (example : 3cawA02) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 06:13
Waiting for 387 new domains (example : 3c9fA01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 03:59
Waiting for 407 new domains (example : 3c8cA02) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2008 23:34
Waiting for 439 new domains (example : 3c5mC00) to be processed so that they can be scanned against too.
Flow stage update by auto on 30 Nov 2008 23:34
No satisfactory AssignClose result found.
Flow stage update by auto on 30 Nov 2008 23:09
No in_process hits for Domain "3c5mA00" ready to be processed
Flow stage update by auto on 30 Nov 2008 23:09
NW result present for Domain "3c5mA00"
Flow stage update by auto on 28 Nov 2008 11:14
All required files are present for Domain "3c5mA00"
Flow stage update by auto on 27 Nov 2008 20:08
Beginning processing for Domain "3c5mA00"
Insertion by cuff on 27 Nov 2008 16:30
nice chopping
