CATH Domain: 3c4nA02 XML data for domain: 3c4nA02

Molscript image for 3c4nA02
3c4nA02
PDB coordinates for domain 3c4nA02

PDB 3c4n, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.9 D-Amino Acid Oxidase; Chain A, domain 2
3.30.9.10 D-Amino Acid Oxidase, subunit A, domain 2 Gene3D
3.30.9.10.8
3.30.9.10.8.1
3.30.9.10.8.1.1
3.30.9.10.8.1.1.1
3.30.9.10.8.1.1.1.1

[top]
Segment boundaries for domain 3c4nA02

Chopping figure for domain 3c4nA02
DomainStart PDB ResidueStop PDB Residue
3c4nA01 34 121
3c4nA01 164 258
3c4nA01 342 399
3c4nA02 122 163
3c4nA02 259 341

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3c4nA02
PLLHLLPAGEGSGLTPTLDALADFPEALALLDPARLPVARVDRLDLLSGAQTPVLRASGLTLRPQNGGYTLVPAIHHRDP
HGYHPAGGSLTGVPTGLRRELLEDLVGLDAVPALAGEGLELGRS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c4nA02
PLLHLLPAGEGSGLTPTLDALADFPEALALLDPARLPVARVDRLDLLSGAQTPVLRASGLTLRPQNGGYTLVPAIHHRDP
HGYHPAGGSLTGVPTGLRRELLEDLVGLXDAVPALAGEGLELGRS
BLAST against CATH

[top]
Domain History Events (64)

Domain assigned by cuff on 26 Mar 2009 19:53

same superfamily

Domain assignment manual match h by cuff on 26 Mar 2009 19:42

same superfamily

Homcheck allotment by cuff on 26 Mar 2009 19:35

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 26 Mar 2009 19:35

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 18:10

Domain "3c4nA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 18:10

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3c4nA02

Flow stage update by auto on 19 Mar 2009 15:11

Retrieved PRC_PFAMCATH results for job ID SID1412267497057872 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 15:11

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 3c4nA02

Update comment by auto on 06 Mar 2009 15:29

PRC_PFAMCATH job SID1412267497057872 is not yet finished.

Flow stage update by auto on 06 Mar 2009 15:19

The entry "3c4nA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 06 Mar 2009 15:19

The entry "3c4nA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Mar 2009 14:37

Retrieved SSAP results for job ID SID1444114853720256 and results inserted.

Domain scan ssap cath by auto on 06 Mar 2009 14:36

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 403 results for 3c4nA02

Update comment by auto on 04 Mar 2009 09:16

SSAP job SID1444114853720256 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 08:57

The entry "3c4nA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:57

The entry "3c4nA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 07:29

Retrieved PRC results for job ID SID0033149665327378 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 07:29

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 3c4nA02

Flow stage update by auto on 04 Mar 2009 06:11

The entry "3c4nA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 04 Mar 2009 06:11

The entry "3c4nA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 04:40

Retrieved HMM(SAM) results for job ID SID0578230320258880 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 04:40

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3c4nA02

Update comment by auto on 04 Mar 2009 01:11

HMM(SAM) job SID0578230320258880 is not yet finished.

Flow stage update by auto on 03 Mar 2009 23:42

The entry "3c4nA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Mar 2009 23:42

The entry "3c4nA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:02

Unable to retrieve "3c4nA02" HMM(SAM) results for job "SID3826413838219456"

Update comment by auto on 19 Feb 2009 08:38

HMM(SAM) job SID3826413838219456 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:10

The entry "3c4nA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:10

The entry "3c4nA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:20

Unable to retrieve "3c4nA02" HMM(SAM) results for job "SID9989060790359344"

Update comment by auto on 22 Jan 2009 17:48

HMM(SAM) job SID9989060790359344 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:30

The entry "3c4nA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:30

The entry "3c4nA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:04

Unable to retrieve "3c4nA02" HMM(SAM) results for job "SID8502595957216560"

Update comment by auto on 03 Dec 2008 11:05

HMM(SAM) job SID8502595957216560 is not yet finished.

Flow stage update by auto on 03 Dec 2008 10:53

The entry "3c4nA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Dec 2008 10:53

The entry "3c4nA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 06:04

Retrieved "3c4nA02" CATHEDRAL results for job ID SID3957626519889088 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 06:01

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 296 results for 3c4nA02

Update comment by auto on 03 Dec 2008 00:55

"3c4nA02" CATHEDRAL job SID3957626519889088 is not yet finished.

Cathedral cath submit by auto on 03 Dec 2008 00:19

The entry "3c4nA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:19

The entry "3c4nA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:43

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3c4nA02.scanlist" for "3c4nA02"

Write scan list by auto on 02 Dec 2008 23:43

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3c4nA02.scanlist" for domain "3c4nA02"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:27

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:31

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 11:55

Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 08:56

Waiting for 355 new domains (example : 3cawA02) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 06:13

Waiting for 387 new domains (example : 3c9fA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 03:59

Waiting for 407 new domains (example : 3c8cA02) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 23:34

Waiting for 439 new domains (example : 3c5mC00) to be processed so that they can be scanned against too.

Flow stage update by auto on 30 Nov 2008 23:34

No satisfactory AssignClose result found.

Flow stage update by auto on 30 Nov 2008 23:09

No in_process hits for Domain "3c4nA02" ready to be processed

Flow stage update by auto on 30 Nov 2008 23:09

NW result present for Domain "3c4nA02"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3c4nA02"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3c4nA02"

Insertion by cuff on 27 Nov 2008 17:22

nice chopping