Domain assigned by auto on 25 Feb 2008 20:17
Assigning to "1.20.142.10" based on similarity with "2pa9A01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3c4hA01 | 176 | 322 |
| 3c4hA02 | 323 | 532 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|3c4hA01 SMKRVQPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEALKGPTDGGQSLEELSS HFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEVPHPLDRDYQLL
Assigning to "1.20.142.10" based on similarity with "2pa9A01"
No in_process hits for Domain "3c4hA01" ready to be processed
NW result present for Domain "3c4hA01"
All required files are present for Domain "3c4hA01"
Beginning processing for Domain "3c4hA01"
Final ChopClose added based on similarity with "2pa9A"