CATH Domain: 3c3jA02 XML data for domain: 3c3jA02

Molscript image for 3c3jA02
3c3jA02
PDB coordinates for domain 3c3jA02

PDB 3c3j, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.10490 Glucose-6-phosphate isomerase like protein; domain 1 Gene3D
3.40.50.10490.10
3.40.50.10490.10.2
3.40.50.10490.10.2.1
3.40.50.10490.10.2.1.1
3.40.50.10490.10.2.1.1.1

[top]
Segment boundaries for domain 3c3jA02

Chopping figure for domain 3c3jA02
DomainStart PDB ResidueStop PDB Residue
3c3jA01 4 197
3c3jA02 198 376

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.40.50.10490.10.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1j5xA02 84.81 Thermotoga maritimaPutative uncharacterized protein 3.40.50.10490 146 20 79 1.92 2.42
1moqA02 84.59 Amino sugar and nucleotide sugar metabolismMetabolic pathwaysAlanine, aspartate and glutamate metabolismGlucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]UDP-N-acetylglucosamine biosynthetic process 3.40.50.10490 148 19 80 2.04 2.53
1m3sB00 81.31 Bacillus subtilis3-hexulose-6-phosphate isomerasePentose and glucuronate interconversions6-phospho-3-hexuloisomerase [EC:5.3.1.27]Methane metabolism 3.40.50.10490 177 8 85 3.61 4.23
1j5xA01 80.31 Thermotoga maritimaPutative uncharacterized protein 3.40.50.10490 155 9 79 2.92 3.68
1tzbA02 78.89 Amino sugar and nucleotide sugar metabolismBifunctional phosphoglucose/phosphomannose isomeraseGlucose-6-phosphate isomerase [EC:5.3.1.9]Fructose and mannose metabolismMetabolic pathways 3.40.50.10490 139 10 76 3.11 4.06
2q8nA02 76.05 Thermotoga maritimaAmino sugar and nucleotide sugar metabolismGlucose-6-phosphate isomeraseGlucose-6-phosphate isomerase [EC:5.3.1.9]Metabolic pathways 3.40.50.10490 162 9 78 3.69 4.71
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3c3jA02
RDVADRCQAILTSLGDFSEGVFGYAPWKRIVYLGSGGLQGAARESALKVLELTAGKLAAFYDSPTGFRHGPKSLVDDETL
VVVFVSSHPYTRQYDLDLLAELRRDNQARVIAIAAESSDIVAAGPHIILPPSRHFIDVEQAFCFLYAQTFALQSLHGNTP
DTPG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c3jA02
RDVADRCQAILTSLGDFSEGVFGYAPWKRIVYLGSGGLQGAARESALKVLELTAGKLAAFYDSPTGFRHGPKSLVDDETL
VVVFVSSHPYTRQYDLDLLAELRRDNQAXRVIAIAAESSDIVAAGPHIILPPSRHFIDVEQAFCFLXYAQTFALXQSLHX
GNTPDTPSASGTVNRVVQG
BLAST against CATH

[top]
Domain History Events (64)

Domain assigned by cuff on 26 Mar 2009 17:25

homology match

Domain assignment manual match h by cuff on 26 Mar 2009 17:22

same superfamily

Homcheck allotment by cuff on 26 Mar 2009 17:20

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 26 Mar 2009 17:20

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 18:08

Domain "3c3jA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 18:08

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3c3jA02

Flow stage update by auto on 19 Mar 2009 15:08

Retrieved PRC_PFAMCATH results for job ID SID5543847823783768 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 15:07

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 15 results for 3c3jA02

Update comment by auto on 06 Mar 2009 15:29

PRC_PFAMCATH job SID5543847823783768 is not yet finished.

Prc pfamcath submit by auto on 06 Mar 2009 15:19

The entry "3c3jA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Mar 2009 15:19

The entry "3c3jA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Mar 2009 14:33

Retrieved SSAP results for job ID SID5682817374386432 and results inserted.

Domain scan ssap cath by auto on 06 Mar 2009 14:31

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2479 results for 3c3jA02

Update comment by auto on 04 Mar 2009 09:16

SSAP job SID5682817374386432 is not yet finished.

Flow stage update by auto on 04 Mar 2009 08:57

The entry "3c3jA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 04 Mar 2009 08:57

The entry "3c3jA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 07:27

Retrieved PRC results for job ID SID9504025365843584 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 07:26

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 15 results for 3c3jA02

Prc cath submit by auto on 04 Mar 2009 06:10

The entry "3c3jA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:10

The entry "3c3jA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 04:38

Retrieved HMM(SAM) results for job ID SID6018229310759840 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 04:37

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 10 results for 3c3jA02

Update comment by auto on 04 Mar 2009 01:11

HMM(SAM) job SID6018229310759840 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:42

The entry "3c3jA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:42

The entry "3c3jA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:02

Unable to retrieve "3c3jA02" HMM(SAM) results for job "SID1670031277580480"

Update comment by auto on 19 Feb 2009 08:38

HMM(SAM) job SID1670031277580480 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:10

The entry "3c3jA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:10

The entry "3c3jA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:20

Unable to retrieve "3c3jA02" HMM(SAM) results for job "SID5713132652644852"

Update comment by auto on 22 Jan 2009 17:48

HMM(SAM) job SID5713132652644852 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:30

The entry "3c3jA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:30

The entry "3c3jA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:04

Unable to retrieve "3c3jA02" HMM(SAM) results for job "SID8374632523066056"

Update comment by auto on 03 Dec 2008 11:05

HMM(SAM) job SID8374632523066056 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 10:52

The entry "3c3jA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:52

The entry "3c3jA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 05:46

Retrieved "3c3jA02" CATHEDRAL results for job ID SID0989463177533160 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 05:42

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 466 results for 3c3jA02

Update comment by auto on 03 Dec 2008 00:55

"3c3jA02" CATHEDRAL job SID0989463177533160 is not yet finished.

Flow stage update by auto on 03 Dec 2008 00:18

The entry "3c3jA02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Dec 2008 00:18

The entry "3c3jA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:42

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3c3jA02.scanlist" for "3c3jA02"

Write scan list by auto on 02 Dec 2008 23:42

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3c3jA02.scanlist" for domain "3c3jA02"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:27

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:31

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 11:55

Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 08:56

Waiting for 355 new domains (example : 3cawA02) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 06:13

Waiting for 387 new domains (example : 3c9fA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 03:59

Waiting for 407 new domains (example : 3c8cA02) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 23:34

Waiting for 439 new domains (example : 3c5mC00) to be processed so that they can be scanned against too.

Flow stage update by auto on 30 Nov 2008 23:33

No satisfactory AssignClose result found.

Flow stage update by auto on 30 Nov 2008 23:09

No in_process hits for Domain "3c3jA02" ready to be processed

Flow stage update by auto on 30 Nov 2008 23:09

NW result present for Domain "3c3jA02"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3c3jA02"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3c3jA02"

Insertion by cuff on 27 Nov 2008 16:20

nice chopping