CATH Domain: 3c3jA01 XML data for domain: 3c3jA01

Molscript image for 3c3jA01
3c3jA01
PDB coordinates for domain 3c3jA01

PDB 3c3j, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.10490 Glucose-6-phosphate isomerase like protein; domain 1 Gene3D
3.40.50.10490.5
3.40.50.10490.5.2
3.40.50.10490.5.2.1
3.40.50.10490.5.2.1.1
3.40.50.10490.5.2.1.1.1

[top]
Segment boundaries for domain 3c3jA01

Chopping figure for domain 3c3jA01
DomainStart PDB ResidueStop PDB Residue
3c3jA01 4 197
3c3jA02 198 376

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.40.50.10490.5.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1j5xA01 82.30 Thermotoga maritimaPutative uncharacterized protein 3.40.50.10490 155 24 74 2.34 3.14
2yvaA00 81.72 DnaA initiator-associating proteinDnaA initiator-associating protein diaAEscherichia coli K-12 3.40.50.10490 193 14 84 3.79 4.51
3ff1B02 76.86 Amino sugar and nucleotide sugar metabolismMetabolic pathwaysStarch and sucrose metabolismPentose phosphate pathwayGlycolysis / Gluconeogenesis 3.40.50.10490 179 12 84 4.12 4.90
1moqA02 76.20 Amino sugar and nucleotide sugar metabolismMetabolic pathwaysAlanine, aspartate and glutamate metabolismGlucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]UDP-N-acetylglucosamine biosynthetic process 3.40.50.10490 148 10 71 3.49 4.91
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3c3jA01
NYTPAAAATGTWTEEEIRHQPRAWIRSLTNIDALRSALNNFLEPLLRKENLRIILTGAGTSAFIGDIIAPWLASHTGKNF
SAVPTTDLVTNPDYLNPAHPLLLISFGRSGNSPESVAAVELANQFVPECYHLPITCNEAGALYQNAINSDNAFALLPAET
HDRGFATSSITTASCLAVFAPETINSQTF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c3jA01
XPENYTPAAAATGTWTEEEIRHQPRAWIRSLTNIDALRSALNNFLEPLLRKENLRIILTGAGTSAFIGDIIAPWLASHTG
KNFSAVPTTDLVTNPXDYLNPAHPLLLISFGRSGNSPESVAAVELANQFVPECYHLPITCNEAGALYQNAINSDNAFALL
XPAETHDRGFAXTSSITTXXASCLAVFAPETINSQTF
BLAST against CATH

[top]
Domain History Events (65)

Domain assigned by cuff on 26 Mar 2009 17:18

homology match

Domain assignment manual match h by cuff on 26 Mar 2009 17:14

same superfamily

Homcheck allotment by cuff on 26 Mar 2009 17:12

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 26 Mar 2009 17:12

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 18:07

Domain "3c3jA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 18:07

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3c3jA01

Flow stage update by auto on 19 Mar 2009 15:07

Retrieved PRC_PFAMCATH results for job ID SID9970799942113172 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 15:06

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 15 results for 3c3jA01

Update comment by auto on 06 Mar 2009 15:29

PRC_PFAMCATH job SID9970799942113172 is not yet finished.

Prc pfamcath submit by auto on 06 Mar 2009 15:19

The entry "3c3jA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Mar 2009 15:19

The entry "3c3jA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Mar 2009 14:31

Retrieved SSAP results for job ID SID6562194838282720 and results inserted.

Domain scan ssap cath by auto on 06 Mar 2009 14:30

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1844 results for 3c3jA01

Update comment by auto on 04 Mar 2009 09:16

SSAP job SID6562194838282720 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 08:57

The entry "3c3jA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:57

The entry "3c3jA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 07:26

Retrieved PRC results for job ID SID7356535876420863 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 07:25

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 19 results for 3c3jA01

Prc cath submit by auto on 04 Mar 2009 06:10

The entry "3c3jA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:10

The entry "3c3jA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 04:37

Retrieved HMM(SAM) results for job ID SID3401782525563872 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 04:36

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 13 results for 3c3jA01

Update comment by auto on 04 Mar 2009 01:10

HMM(SAM) job SID3401782525563872 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:41

The entry "3c3jA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:41

The entry "3c3jA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:02

Unable to retrieve "3c3jA01" HMM(SAM) results for job "SID7109340572078656"

Update comment by auto on 19 Feb 2009 08:38

HMM(SAM) job SID7109340572078656 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:10

The entry "3c3jA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:10

The entry "3c3jA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:20

Unable to retrieve "3c3jA01" HMM(SAM) results for job "SID8498018777466208"

Update comment by auto on 22 Jan 2009 17:48

HMM(SAM) job SID8498018777466208 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:30

The entry "3c3jA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:30

The entry "3c3jA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:04

Unable to retrieve "3c3jA01" HMM(SAM) results for job "SID8276473637051088"

Update comment by auto on 03 Dec 2008 11:05

HMM(SAM) job SID8276473637051088 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 10:52

The entry "3c3jA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:52

The entry "3c3jA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 05:51

Retrieved "3c3jA01" CATHEDRAL results for job ID SID4366033002736732 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 05:46

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 499 results for 3c3jA01

Update comment by auto on 03 Dec 2008 00:55

"3c3jA01" CATHEDRAL job SID4366033002736732 is not yet finished.

Flow stage update by auto on 03 Dec 2008 00:18

The entry "3c3jA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Dec 2008 00:18

The entry "3c3jA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:42

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3c3jA01.scanlist" for "3c3jA01"

Write scan list by auto on 02 Dec 2008 23:42

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3c3jA01.scanlist" for domain "3c3jA01"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:27

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:31

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 11:55

Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 08:56

Waiting for 355 new domains (example : 3cawA02) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 06:13

Waiting for 387 new domains (example : 3c9fA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 03:59

Waiting for 407 new domains (example : 3c8cA02) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 23:34

Waiting for 439 new domains (example : 3c5mC00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 22:03

Waiting for 476 new domains (example : 3c3jA02) to be processed so that they can be scanned against too.

Flow stage update by auto on 30 Nov 2008 20:37

No satisfactory AssignClose result found.

Flow stage update by auto on 30 Nov 2008 20:15

No in_process hits for Domain "3c3jA01" ready to be processed

Flow stage update by auto on 30 Nov 2008 20:15

NW result present for Domain "3c3jA01"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3c3jA01"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3c3jA01"

Insertion by cuff on 27 Nov 2008 16:20

nice chopping