CATH Domain: 3c2bA01 XML data for domain: 3c2bA01

Molscript image for 3c2bA01
3c2bA01
PDB coordinates for domain 3c2bA01

PDB 3c2b, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.10 Arc Repressor Mutant, subunit A
1.10.10.60 Homeodomain-like Gene3D
1.10.10.60.30
1.10.10.60.30.1
1.10.10.60.30.1.1
1.10.10.60.30.1.1.1
1.10.10.60.30.1.1.1.1

[top]
Segment boundaries for domain 3c2bA01

Chopping figure for domain 3c2bA01
DomainStart PDB ResidueStop PDB Residue
3c2bA01 12 63
3c2bA02 65 214

Structural Neighbourhood (26 entries)

There are 26 matching structural neighberhood comparisons for CATH ID 1.10.10.60.30.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 26 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bqzA01 91.52 HTH-type transcriptional regulator qacRStaphylococcus aureus subsp. aureus Mu50 1.10.10.60 49 26 94 1.38 1.47
3f0cA01 89.38 Cytophaga hutchinsonii ATCC 33406Transcriptional regulator 1.10.10.60 47 25 92 2.04 2.21
1zk8A01 89.24 Transcriptional regulator, TetR familyBacillus cereus ATCC 14579 1.10.10.60 46 17 86 2.13 2.47
1zkgA01 88.82 Thermotoga maritimaTranscriptional regulator, TetR family 1.10.10.60 46 21 86 1.84 2.13
2raeA01 88.63 Rhodococcus jostii RHA1Transcriptional regulator, AcrR family protein 1.10.10.60 43 20 82 1.14 1.38
2hyjA01 88.50 Streptomyces coelicolorPutative tetR-family transcriptional regulator 1.10.10.60 46 23 82 1.31 1.59
3ccyA01 88.38 Bordetella parapertussisPutative TetR-family transcriptional regulator 1.10.10.60 44 25 82 1.16 1.41
2hxoA01 86.88 Streptomyces coelicolorPutative TetR-family transcriptional regulator 1.10.10.60 63 25 79 1.97 2.48
1sauA02 83.66 Archaeoglobus fulgidusSulfite reductase, desulfoviridin-type subunit gamma (DsvC) 1.10.10.370 70 13 72 1.74 2.39
2dmqA01 80.94 LIM/homeobox protein Lhx9Homo sapiens 1.10.10.60 57 15 80 3.94 4.88
1hlvA01 80.85 Centromere protein BMajor centromere autoantigen BHomo sapiensChromosome, centromeric region 1.10.10.60 58 11 74 3.23 4.36
1ng6A02 79.93 Hypothetical proteinBacillus subtilisUncharacterized protein yqeY 1.10.10.410 57 7 80 3.71 4.60
1ojlA03 79.44 Two-component systemTwo-component system, NtrC family, response regulator HydGTranscriptional regulatory protein zraRSalmonella enterica subsp. enterica serovar Typhimurium 1.10.10.60 47 12 76 2.79 3.65
1e3oC02 79.23 POU domain transcription factor, class 2POU domain, class 2, transcription factor 1Protein bindingSequence-specific DNA binding transcription factor activityNegative regulation of transcription, DNA-dependent 1.10.10.60 48 14 72 3.51 4.84
1rr7A02 79.17 Middle operon regulatorEnterobacteria phage Mu 1.10.10.60 48 12 86 3.85 4.46
1jusD01 78.78 HTH-type transcriptional regulator qacRStaphylococcus aureus 1.10.10.60 49 12 50 0.80 1.57
1gdtB03 78.59 Transposon gamma-delta resolvaseEscherichia coli K-12 1.10.10.60 45 11 78 3.89 4.96
1umqA00 77.60 Rhodobacter sphaeroides 2.4.1Photosynthetic apparatus regulatory protein regA 1.10.10.60 60 9 66 3.26 4.89
1iv6A00 75.65 Positive regulation of mitotic cell cycleProtein homooligomerizationNegative regulation of telomerase activityTelomere maintenance via telomere shorteningG2/M transition of mitotic cell cycle 1.10.10.60 57 9 82 3.82 4.63
2f48A03 75.44 Fructose and mannose metabolismPyrophosphate--fructose-6-phosphate 1-phosphotransferase [EC:2.7.1.90]Borrelia burgdorferiPyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta subunit (PfpB) 1.10.10.480 75 9 65 3.05 4.67
1a6qA02 74.52 Protein phosphatase 1AWnt receptor signaling pathwayProtein phosphatase 1A (formerly 2C) [EC:3.1.3.16]Positive regulation of transcription, DNA-dependentPositive regulation of I-kappaB kinase/NF-kappaB cascade 1.10.10.430 69 7 68 3.08 4.52
1tkvA00 71.62 10 kDa anti-sigma factorEnterobacteria phage T4 1.10.1810.10 88 11 53 2.66 4.98
2yveB00 69.80 Corynebacterium glutamicumBacterial regulatory protein, TetR family 1.10.357.10 172 29 29 1.35 4.55
2g3bA00 68.24 Rhodococcus jostii RHA1Possible transcriptional regulator, TetR family protein 1.10.357.10 184 33 27 1.12 4.12
3cjdA00 68.20 Jannaschia sp. CCS1Transcriptional regulator, TetR family 1.10.357.10 175 25 29 1.41 4.84
2gfnA00 67.69 Rhodococcus jostii RHA1Probable transcriptional regulator, TetR family protein 1.10.357.10 190 35 26 1.31 4.88
[1]
Displaying entries 1 to 26 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3c2bA01
SPRQNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFGDRDGLLAA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c2bA01
GHXASDPITTQEFSPRQNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFGDRDGLLAA
BLAST against CATH

[top]
Domain History Events (68)

Domain assigned by cuff on 20 Apr 2009 15:35

homology match

Domain assignment manual match h by cuff on 20 Apr 2009 15:27

same superfamily

Homcheck allotment by cuff on 26 Mar 2009 16:02

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 26 Mar 2009 16:02

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 18:01

Domain "3c2bA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 18:00

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3c2bA01

Flow stage update by auto on 19 Mar 2009 14:59

Retrieved PRC_PFAMCATH results for job ID SID5522353758300512 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 14:58

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 55 results for 3c2bA01

Update comment by auto on 05 Mar 2009 11:57

PRC_PFAMCATH job SID5522353758300512 is not yet finished.

Prc pfamcath submit by auto on 05 Mar 2009 11:51

The entry "3c2bA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Mar 2009 11:51

The entry "3c2bA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Mar 2009 11:31

Retrieved SSAP results for job ID SID1882406367971280 and results inserted.

Domain scan ssap cath by auto on 05 Mar 2009 11:25

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2244 results for 3c2bA01

Update comment by auto on 04 Mar 2009 09:15

SSAP job SID1882406367971280 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 08:56

The entry "3c2bA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:56

The entry "3c2bA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 07:19

Retrieved PRC results for job ID SID1621310916172754 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 07:19

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 51 results for 3c2bA01

Prc cath submit by auto on 04 Mar 2009 06:09

The entry "3c2bA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:09

The entry "3c2bA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 04:31

Retrieved HMM(SAM) results for job ID SID3334791957754832 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 04:30

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 43 results for 3c2bA01

Update comment by auto on 04 Mar 2009 01:10

HMM(SAM) job SID3334791957754832 is not yet finished.

Flow stage update by auto on 03 Mar 2009 23:40

The entry "3c2bA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Mar 2009 23:40

The entry "3c2bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:01

Unable to retrieve "3c2bA01" HMM(SAM) results for job "SID8546468768119776"

Update comment by auto on 19 Feb 2009 08:37

HMM(SAM) job SID8546468768119776 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:09

The entry "3c2bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:09

The entry "3c2bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:19

Unable to retrieve "3c2bA01" HMM(SAM) results for job "SID5818366640741920"

Update comment by auto on 22 Jan 2009 17:47

HMM(SAM) job SID5818366640741920 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:29

The entry "3c2bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:29

The entry "3c2bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Dec 2008 17:32

Unable to retrieve "3c2bA01" HMM(SAM) results for job "SID6786697364802192"

Update comment by auto on 03 Dec 2008 15:03

HMM(SAM) job SID6786697364802192 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 15:00

The entry "3c2bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:00

The entry "3c2bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 11:04

Unable to retrieve "3c2bA01" HMM(SAM) results for job "SID9139785302909304"

Update comment by auto on 03 Dec 2008 01:11

HMM(SAM) job SID9139785302909304 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 01:10

The entry "3c2bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 01:10

The entry "3c2bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 00:54

Retrieved "3c2bA01" CATHEDRAL results for job ID SID2363831767538664 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 00:53

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 76 results for 3c2bA01

Cathedral cath submit by auto on 03 Dec 2008 00:16

The entry "3c2bA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:16

The entry "3c2bA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:40

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3c2bA01.scanlist" for "3c2bA01"

Write scan list by auto on 02 Dec 2008 23:40

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3c2bA01.scanlist" for domain "3c2bA01"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:27

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:31

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 11:55

Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 08:56

Waiting for 355 new domains (example : 3cawA02) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 06:13

Waiting for 387 new domains (example : 3c9fA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 03:58

Waiting for 407 new domains (example : 3c8cA02) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 23:34

Waiting for 439 new domains (example : 3c5mC00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 22:03

Waiting for 476 new domains (example : 3c3jA02) to be processed so that they can be scanned against too.

Flow stage update by auto on 30 Nov 2008 20:37

No satisfactory AssignClose result found.

Flow stage update by auto on 30 Nov 2008 20:15

No in_process hits for Domain "3c2bA01" ready to be processed

Flow stage update by auto on 30 Nov 2008 20:15

NW result present for Domain "3c2bA01"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3c2bA01"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3c2bA01"

Insertion by cuff on 27 Nov 2008 16:20

nice chopping