Domain assigned by auto on 03 Mar 2009 21:40
Assigning to "3.10.100.10" based on similarity with "3c22A00"
There are 21 matching structural neighberhood comparisons for CATH ID 3.10.100.10.3.1.1.1.1 (SIMAX score < 5)
>pdb|3c22D00 VSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNK VQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
Assigning to "3.10.100.10" based on similarity with "3c22A00"
No in_process hits for Domain "3c22D00" ready to be processed
Domain "3c22D00" hits Domain "3c22A00" (100% over 99.2537313432836%) which is currently in process
Domain "3c22D00" hits Domain "3c22A00" (100% over 99.2537313432836%) which is currently in process
NW result present for Domain "3c22D00"
All required files are present for Domain "3c22D00"
Beginning processing for Domain "3c22D00"
Final ChopClose added based on similarity with "3c22C"