CATH Domain: 3c18A01 XML data for domain: 3c18A01

Molscript image for 3c18A01
3c18A01
PDB coordinates for domain 3c18A01

PDB 3c18, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.460 Beta Polymerase; domain 2
3.30.460.10 Beta Polymerase, domain 2 Gene3D
3.30.460.10.3
3.30.460.10.3.1
3.30.460.10.3.1.1
3.30.460.10.3.1.1.1
3.30.460.10.3.1.1.1.1

[top]
Segment boundaries for domain 3c18A01

Chopping figure for domain 3c18A01
DomainStart PDB ResidueStop PDB Residue
3c18A01 0 114
3c18A02 115 232
3c18A03 233 289

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3c18A01
GEQATRTIYSEYAAYPETQGIIAVEKRQPRDSLTDQFDVLLLVITRDPSVEWTVKHYRLNTLRVSLHLVHEQVLSRWLIL
NANRRAVHWVSEGTIIFERNDYLTDLKKQLRNFP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c18A01
GXEQATRTIYSEYAAYPETQGIIAVEKRQPRDSLTDQFDVLLLVITRDPSVEWTVKHYRLNTLRVSLHLVHEQVLSRWLI
LNANRRAVHWVSEGTIIFERNDYLTDLKKQLRNFP
BLAST against CATH

[top]
Domain History Events (65)

Domain assigned by cuff on 26 Mar 2009 12:03

same superfamily

Domain assignment manual match h by cuff on 26 Mar 2009 11:59

homology match

Homcheck allotment by cuff on 26 Mar 2009 11:56

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 26 Mar 2009 11:56

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 17:52

Domain "3c18A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 17:52

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3c18A01

Flow stage update by auto on 19 Mar 2009 14:47

Retrieved PRC_PFAMCATH results for job ID SID8717228358572672 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 14:47

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 3c18A01

Update comment by auto on 05 Mar 2009 22:01

PRC_PFAMCATH job SID8717228358572672 is not yet finished.

Prc pfamcath submit by auto on 05 Mar 2009 21:53

The entry "3c18A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Mar 2009 21:53

The entry "3c18A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Mar 2009 21:20

Retrieved SSAP results for job ID SID0336358130158832 and results inserted.

Domain scan ssap cath by auto on 05 Mar 2009 21:17

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2074 results for 3c18A01

Update comment by auto on 04 Mar 2009 09:14

SSAP job SID0336358130158832 is not yet finished.

Flow stage update by auto on 04 Mar 2009 08:54

The entry "3c18A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 04 Mar 2009 08:54

The entry "3c18A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 07:11

Retrieved PRC results for job ID SID4495467275394144 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 07:11

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 3c18A01

Update comment by auto on 04 Mar 2009 01:51

PRC job SID4495467275394144 is not yet finished.

Prc cath submit by auto on 04 Mar 2009 01:46

The entry "3c18A01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 01:46

The entry "3c18A01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 01:09

Retrieved HMM(SAM) results for job ID SID3399126651560896 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 01:08

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3c18A01

Sam cath submit by auto on 03 Mar 2009 23:39

The entry "3c18A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:39

The entry "3c18A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:59

Unable to retrieve "3c18A01" HMM(SAM) results for job "SID8689305741706912"

Update comment by auto on 19 Feb 2009 08:36

HMM(SAM) job SID8689305741706912 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:08

The entry "3c18A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:08

The entry "3c18A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:18

Unable to retrieve "3c18A01" HMM(SAM) results for job "SID8740222810874336"

Update comment by auto on 22 Jan 2009 17:46

HMM(SAM) job SID8740222810874336 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:28

The entry "3c18A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:28

The entry "3c18A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:02

Unable to retrieve "3c18A01" HMM(SAM) results for job "SID4208640846338176"

Update comment by auto on 03 Dec 2008 11:03

HMM(SAM) job SID4208640846338176 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 10:51

The entry "3c18A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:51

The entry "3c18A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 04:57

Retrieved "3c18A01" CATHEDRAL results for job ID SID1211793191794730 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 04:54

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 308 results for 3c18A01

Update comment by auto on 03 Dec 2008 00:44

"3c18A01" CATHEDRAL job SID1211793191794730 is not yet finished.

Flow stage update by auto on 03 Dec 2008 00:15

The entry "3c18A01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Dec 2008 00:15

The entry "3c18A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:39

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3c18A01.scanlist" for "3c18A01"

Write scan list by auto on 02 Dec 2008 23:38

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3c18A01.scanlist" for domain "3c18A01"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:27

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:31

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 11:55

Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 08:56

Waiting for 355 new domains (example : 3cawA02) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 06:13

Waiting for 387 new domains (example : 3c9fA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 03:58

Waiting for 407 new domains (example : 3c8cA02) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 23:34

Waiting for 439 new domains (example : 3c5mC00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 22:03

Waiting for 476 new domains (example : 3c3jA02) to be processed so that they can be scanned against too.

Flow stage update by auto on 30 Nov 2008 20:36

No satisfactory AssignClose result found.

Flow stage update by auto on 30 Nov 2008 20:15

No in_process hits for Domain "3c18A01" ready to be processed

Flow stage update by auto on 30 Nov 2008 20:15

NW result present for Domain "3c18A01"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3c18A01"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3c18A01"

Insertion by cuff on 27 Nov 2008 16:20

nice chopping