CATH Domain: 3c10C00 XML data for domain: 3c10C00

Molscript image for 3c10C00
3c10C00
PDB coordinates for domain 3c10C00

PDB 3c10, Chain C, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.800 Arginase; Chain A
3.40.800.20 Gene3D
3.40.800.20.3
3.40.800.20.3.1
3.40.800.20.3.1.1
3.40.800.20.3.1.1.1
3.40.800.20.3.1.1.1.1

Segment boundaries for domain 3c10C00

Chopping figure for domain 3c10C00
DomainStart PDB ResidueStop PDB Residue
3c10C00 519 899

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|3c10C00
TTGLIYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLPCGG
VGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASK
ILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRI
VVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALEGGHDLTAICDASEACVAALL
GNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQ    

Domain COMBS Sequence

>pdb|3c10C00
TTGLIYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLK
LDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMG
FCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVN
VAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLA
LEGGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLAS    

Domain History Events (13)

Domain assigned by auto on 26 Mar 2009 14:21

Assigning to "3.40.800.20" based on similarity with "3c0yC00"

Flow stage update by auto on 26 Mar 2009 14:01

No in_process hits for Domain "3c10C00" ready to be processed

Update comment by auto on 26 Mar 2009 13:39

Domain "3c10C00" hits Domain "3c0yA00" (100% over 98.9717223650386%) which is currently in process

Update comment by auto on 26 Mar 2009 13:15

Domain "3c10C00" hits Domain "3c0yC00" (100% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 12:49

Domain "3c10C00" hits Domain "3c10B00" (100% over 99.2268041237113%) which is currently in process

Update comment by auto on 26 Mar 2009 12:22

Domain "3c10C00" hits Domain "3c0zC00" (100% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 11:56

Domain "3c10C00" hits Domain "3c0zB00" (100% over 99.2268041237113%) which is currently in process

Update comment by auto on 10 Dec 2008 14:21

Domain "3c10C00" hits Domain "3c0yB00" (100% over 99.4832041343669%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

Domain "3c10C00" hits Domain "3c0yB00" (100% over 99.4832041343669%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "3c10C00"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "3c10C00"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "3c10C00"

Insertion by auto on 05 Dec 2008 18:07

Final ChopClose added based on similarity with "3c0zC"