CATH Domain: 3c0wA02 XML data for domain: 3c0wA02

Molscript image for 3c0wA02
3c0wA02
PDB coordinates for domain 3c0wA02

PDB 3c0w, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.28 Endonuclease I-creI
3.10.28.10 Homing endonucleases Gene3D
3.10.28.10.8
3.10.28.10.8.1
3.10.28.10.8.1.1
3.10.28.10.8.1.1.1
3.10.28.10.8.1.1.1.1

[top]
Segment boundaries for domain 3c0wA02

Chopping figure for domain 3c0wA02
DomainStart PDB ResidueStop PDB Residue
3c0wA01 3 122
3c0wA02 123 225

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.10.28.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2vs7D02 80.34 Desulfurococcus mobilisHoming endonuclease I-DmoI 3.10.28.10 87 8 78 3.78 4.81
2vs7A02 79.39 Desulfurococcus mobilisHoming endonuclease I-DmoI 3.10.28.10 78 7 69 3.22 4.61
1dfaA03 79.24 Vacuolar acidificationOxidative phosphorylationCellular protein metabolic processEndodeoxyribonuclease activityProtein binding 3.10.28.10 95 16 79 2.87 3.60
1dq3A03 77.80 Pyrimidine metabolismPyrococcus furiosusPurine metabolismRibonucleoside-diphosphate reductaseRibonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1] 3.10.28.10 87 14 79 3.60 4.52
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3c0wA02
TIPNNLVENYLTPMSLAYWFMDDGGKWDYNKNSTNKSIVLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYIDS
MSYLIFYNLIKPYLIPQMMYKLP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c0wA02
TIPNNLVENYLTPMSLAYWFMDDGGKWDYNKNSTNKSIVLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYIDS
MSYLIFYNLIKPYLIPQMMYKLPNTISSETFLK
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 13 May 2008 17:31

Assigning to "3.10.28.10" based on similarity with "3c0xA02"

Flow stage update by auto on 13 May 2008 17:31

No in_process hits for Domain "3c0wA02" ready to be processed

Update comment by auto on 13 May 2008 17:27

Domain "3c0wA02" hits Domain "3c0xA02" (100% over 100%) which is currently in process

Flow stage update by auto on 13 May 2008 17:10

Domain "3c0wA02" hits Domain "3c0xA02" (100% over 100%) which is currently in process

Flow stage update by auto on 13 May 2008 17:10

NW result present for Domain "3c0wA02"

Flow stage update by auto on 13 May 2008 08:16

All required files are present for Domain "3c0wA02"

Flow stage update by auto on 12 May 2008 12:29

Beginning processing for Domain "3c0wA02"

Insertion by auto on 12 May 2008 11:06

Final ChopClose added based on similarity with "1r7mA"