CATH Domain: 3c0wA01 XML data for domain: 3c0wA01

Molscript image for 3c0wA01
3c0wA01
PDB coordinates for domain 3c0wA01

PDB 3c0w, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.28 Endonuclease I-creI
3.10.28.10 Homing endonucleases Gene3D
3.10.28.10.4
3.10.28.10.4.1
3.10.28.10.4.1.1
3.10.28.10.4.1.1.1
3.10.28.10.4.1.1.1.1

[top]
Segment boundaries for domain 3c0wA01

Chopping figure for domain 3c0wA01
DomainStart PDB ResidueStop PDB Residue
3c0wA01 3 122
3c0wA02 123 225

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3c0wA01
NIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRDEGKTYCMQFEWKNKAYMDHVCLLYDQWVLSP
PHKKERVNHLGNLVITWGAQTFKHQAFNKLANLFIVNNKK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c0wA01
MKNIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRDEGKTYCMQFEWKNKAYMDHVCLLYDQWVL
SPPHKKERVNHLGNLVITWGAQTFKHQAFNKLANLFIVNNKK
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 13 May 2008 17:31

Assigning to "3.10.28.10" based on similarity with "3c0xA01"

Flow stage update by auto on 13 May 2008 17:31

No in_process hits for Domain "3c0wA01" ready to be processed

Update comment by auto on 13 May 2008 17:27

Domain "3c0wA01" hits Domain "3c0xA01" (100% over 100%) which is currently in process

Flow stage update by auto on 13 May 2008 17:10

Domain "3c0wA01" hits Domain "3c0xA01" (100% over 100%) which is currently in process

Flow stage update by auto on 13 May 2008 17:10

NW result present for Domain "3c0wA01"

Flow stage update by auto on 13 May 2008 08:16

All required files are present for Domain "3c0wA01"

Flow stage update by auto on 12 May 2008 12:29

Beginning processing for Domain "3c0wA01"

Insertion by auto on 12 May 2008 11:06

Final ChopClose added based on similarity with "1r7mA"