CATH Domain: 3c0dA00 XML data for domain: 3c0dA00

Molscript image for 3c0dA00
3c0dA00
PDB coordinates for domain 3c0dA00

PDB 3c0d, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.102 3-layer Sandwich
2.102.10 Rieske Iron-sulfur Protein
2.102.10.10 'Rieske'-like iron-sulphur domains Gene3D
2.102.10.10.10
2.102.10.10.10.1
2.102.10.10.10.1.1
2.102.10.10.10.1.1.1
2.102.10.10.10.1.1.1.1

[top]
Segment boundaries for domain 3c0dA00

Chopping figure for domain 3c0dA00
DomainStart PDB ResidueStop PDB Residue
3c0dA00 4 112

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.102.10.10.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2jzaA01 83.49 Nitrogen metabolismNitrite reductase (NAD(P)H) small subunit [EC:1.7.1.4]Nitrite reductase [NAD(P)H] small subunitPectobacterium atrosepticum 2.102.10.10 118 35 88 2.89 3.28
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3c0dA00
LTKVKLCQLDDLPFIGATVLIEGERVALFYIPDSGVYAVQDWDPIGKAYVSRGIVGDINGECVASPLYKQHFSLKSGQCL
EDEAHCLKTWRVTVDDNQVCYLAKEL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c0dA00
XAALTKVKLCQLDDLXPFIGATVLIEGERVALFYIPDSGVYAVQDWDPIGKAYVXSRGIVGDINGEXCVASPLYKQHFSL
KSGQCLEDEAHCLKTWRVTVDDNQVCYLAKELEHHHHHH
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 26 Mar 2009 14:21

Assigning to "2.102.10.10" based on similarity with "3c0dB00"

Flow stage update by auto on 26 Mar 2009 14:01

No in_process hits for Domain "3c0dA00" ready to be processed

Update comment by auto on 26 Mar 2009 13:39

Domain "3c0dA00" hits Domain "3c0dF00" (96.6386554621849% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 13:15

Domain "3c0dA00" hits Domain "3c0dG00" (96.6386554621849% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 12:49

Domain "3c0dA00" hits Domain "3c0dD00" (96.6386554621849% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 12:22

Domain "3c0dA00" hits Domain "3c0dB00" (96.6386554621849% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 11:56

Domain "3c0dA00" hits Domain "3c0dH00" (96.6386554621849% over 100%) which is currently in process

Update comment by auto on 17 Dec 2008 17:18

Domain "3c0dA00" hits Domain "3c0dE00" (96.6386554621849% over 100%) which is currently in process

Flow stage update by auto on 17 Dec 2008 17:14

Domain "3c0dA00" hits Domain "3c0dE00" (96.6386554621849% over 100%) which is currently in process

Flow stage update by auto on 17 Dec 2008 17:14

NW result present for Domain "3c0dA00"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "3c0dA00"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "3c0dA00"

Insertion by auto on 09 Dec 2008 14:28

Final ChopClose added based on similarity with "3c0dB"