CATH Domain: 3bzwF00 XML data for domain: 3bzwF00

Molscript image for 3bzwF00
3bzwF00
PDB coordinates for domain 3bzwF00

PDB 3bzw, Chain F, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1110 Gene3D
3.40.50.1110.6
3.40.50.1110.6.1
3.40.50.1110.6.1.1
3.40.50.1110.6.1.1.1
3.40.50.1110.6.1.1.1.1

[top]
Segment boundaries for domain 3bzwF00

Chopping figure for domain 3bzwF00
DomainStart PDB ResidueStop PDB Residue
3bzwF00 39 285

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.1110.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1z8hA00 80.41 Nostoc sp. PCC 7120Alr1529 protein 3.40.50.1110 197 14 76 3.10 4.05
1yzfA00 79.22 Lipase/acylhydrolaseEnterococcus faecalis 3.40.50.1110 195 18 74 3.37 4.50
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bzwF00
IQHPWQGKKVGYIGDSITDPNNIKKYWDFLKEWLGITPFVYGISGRQWDDVPRQAEKLKKEHGGEVDAILVFGTNDYNSS
VPIGEWFTEQEEQVLSAHGEKKVTRKKRTPVTQDTYRGRINIGITQLKKLFPDKQIVLLTPLHRSLANFGDKNVQPDESY
QNGCGEYIDAYVQAIKEAGNIWGIPVIDFNAVTGNPVEEQLIYFYDAGYDRLHPDTKGQERARTLYQLLALPVAF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bzwF00
IQHPWQGKKVGYIGDSITDPNCYGDNIKKYWDFLKEWLGITPFVYGISGRQWDDVPRQAEKLKKEHGGEVDAILVFXGTN
DYNSSVPIGEWFTEQEEQVLSAHGEXKKXVTRKKRTPVXTQDTYRGRINIGITQLKKLFPDKQIVLLTPLHRSLANFGDK
NVQPDESYQNGCGEYIDAYVQAIKEAGNIWGIPVIDFNAVTGXNPXVEEQLIYFYDAGYDRLHPDTKGQERXARTLXYQL
LALPVAFEGHHHHHH
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 18 Feb 2009 20:36

Assigning to "3.40.50.1110" based on similarity with "3bzwB00"

Flow stage update by auto on 18 Feb 2009 20:11

No in_process hits for Domain "3bzwF00" ready to be processed

Update comment by auto on 18 Feb 2009 19:41

Domain "3bzwF00" hits Domain "3bzwA00" (96.8627450980392% over 99.609375%) which is currently in process

Update comment by auto on 18 Feb 2009 19:15

Domain "3bzwF00" hits Domain "3bzwD00" (96.8627450980392% over 100%) which is currently in process

Update comment by auto on 18 Feb 2009 18:48

Domain "3bzwF00" hits Domain "3bzwE00" (96.8627450980392% over 100%) which is currently in process

Update comment by auto on 18 Feb 2009 18:16

Domain "3bzwF00" hits Domain "3bzwB00" (96.8627450980392% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 11:09

Domain "3bzwF00" hits Domain "3bzwC00" (96.8627450980392% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

Domain "3bzwF00" hits Domain "3bzwC00" (96.8627450980392% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

NW result present for Domain "3bzwF00"

Flow stage update by auto on 21 Nov 2008 11:22

All required files are present for Domain "3bzwF00"

Flow stage update by auto on 20 Nov 2008 23:38

Beginning processing for Domain "3bzwF00"

Insertion by auto on 20 Nov 2008 23:08

Final ChopClose added based on similarity with "3bzwA"