CATH Domain: 3by7E00 XML data for domain: 3by7E00

Molscript image for 3by7E00
3by7E00
PDB coordinates for domain 3by7E00

PDB 3by7, Chain E, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.30 SH3 type barrels.
2.30.30.100 Gene3D
2.30.30.100.12
2.30.30.100.12.1
2.30.30.100.12.1.1
2.30.30.100.12.1.1.1
2.30.30.100.12.1.1.1.1

[top]
Segment boundaries for domain 3by7E00

Chopping figure for domain 3by7E00
DomainStart PDB ResidueStop PDB Residue
3by7E00 3 85

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.30.30.100.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2k57A00 79.60 Pseudomonas syringae pv. phaseolicola 1448ALipoprotein, putative 2.30.30.100 55 18 64 2.62 4.04
1ib8A02 77.93 Hypothetical proteinRibosome maturation factor rimPStreptococcus pneumoniae 2.30.30.180 67 8 67 2.63 3.89
1biaA03 75.85 Biotin metabolismDNA bindingBirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]Bifunctional protein birABiotin-[acetyl-CoA-carboxylase] ligase activity 2.30.30.100 47 10 56 2.46 4.33
2hqxA01 74.31 Staphylococcal nuclease domain-containing protein 1NucleusGolgi apparatusTranscription cofactor activityHomo sapiens 2.30.30.140 81 8 60 2.96 4.89
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3by7E00
NIKIRLVTGEDIIGNISESQGLITIKKAFVIIPVQLVLSPWQPYTDDKEIVIDDSKVITITSPKDDIIKSYESH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3by7E00
GXKNIKIXRLVTGEDIIGNISESQGLITIKKAFVIIPXQATPGKPVQLVLSPWQPYTDDKEIVIDDSKVITITSPKDDII
KSYESHTSEIITPSGLITET
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 03 Mar 2009 21:39

Assigning to "2.30.30.100" based on similarity with "3by7A00"

Flow stage update by auto on 03 Mar 2009 21:28

No in_process hits for Domain "3by7E00" ready to be processed

Update comment by auto on 03 Mar 2009 21:00

Domain "3by7E00" hits Domain "3by7D00" (97% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 11:09

Domain "3by7E00" hits Domain "3by7A00" (97% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

Domain "3by7E00" hits Domain "3by7A00" (97% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

NW result present for Domain "3by7E00"

Flow stage update by auto on 21 Nov 2008 11:22

All required files are present for Domain "3by7E00"

Flow stage update by auto on 20 Nov 2008 23:38

Beginning processing for Domain "3by7E00"

Insertion by auto on 20 Nov 2008 23:18

Final ChopClose added based on similarity with "3by7A"