CATH Domain: 3by5A00

3by5A00

PDB 3by5, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.420	Nucleotidyltransferase; domain 5
3.30.420.180	Biosynthetic like domain	Gene3D
3.30.420.180.1
3.30.420.180.1.1
3.30.420.180.1.1.1
3.30.420.180.1.1.1.1
3.30.420.180.1.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3by5A00

Domain	Start PDB Residue	Stop PDB Residue
3by5A00	8	130

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.

[top]
Domain ATOM Sequence

>pdb|3by5A00
VTVAGIGCRKGAASDAIIAAVRAAERAFGVTVDYLATAPLKADEAGLAEAAKGLSLSLEIVAQERLEAVAAETTFSQASL
DHSGSPSVSEAAALAAAGAGARLVAPRLVVGDVTVAIATSD

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3by5A00
XSLELGQAXVTVAGIGCRKGAASDAIIAAVRAAERAFGVTVDYLATAPLKADEAGLAEAAKGLSLSLEIVAQERLEAVAA
ETXTFSQASLDHSGSPSVSEAAALAAAGAGARLVAPRLVVGDVTVAIAXTSD

BLAST against CATH

[top]
Domain History Events (46)

Domain assigned by cuff on 23 Feb 2009 18:42

new superfamily

Domain assignment manual match t by cuff on 23 Feb 2009 18:39

not convinced regarding homology but definately same fold

Homcheck allotment by cuff on 11 Feb 2009 17:47

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 11 Feb 2009 17:47

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Nov 2008 11:41

Domain "3by5A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Nov 2008 11:40

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3by5A00

Flow stage update by auto on 28 Nov 2008 11:35

Retrieved PRC_PFAMCATH results for job ID SID0092539627173490 and results inserted.

Domain scan prc pfamcath by auto on 28 Nov 2008 11:35

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 3by5A00

Update comment by auto on 28 Nov 2008 09:21

PRC_PFAMCATH job SID0092539627173490 is not yet finished.

Flow stage update by auto on 28 Nov 2008 09:18

The entry "3by5A00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 28 Nov 2008 09:18

The entry "3by5A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Nov 2008 09:14

Retrieved SSAP results for job ID SID2345454044716768 and results inserted.

Domain scan ssap cath by auto on 28 Nov 2008 09:07

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2757 results for 3by5A00

Update comment by auto on 27 Nov 2008 07:25

SSAP job SID2345454044716768 is not yet finished.

Flow stage update by auto on 27 Nov 2008 07:19

The entry "3by5A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 27 Nov 2008 07:19

The entry "3by5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 27 Nov 2008 07:07

Retrieved PRC results for job ID SID6209305307306880 and inserted them into the database.

Domain scan prc cath by auto on 27 Nov 2008 07:07

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 3by5A00

Prc cath submit by auto on 27 Nov 2008 06:36

The entry "3by5A00" has been submitted to the PRC webservice.

Flow stage update by auto on 27 Nov 2008 06:36

The entry "3by5A00" has been submitted to the PRC webservice.

Flow stage update by auto on 27 Nov 2008 06:21

Retrieved HMM(SAM) results for job ID SID2921332370611760 and inserted them into the database.

Domain scan sam cath by auto on 27 Nov 2008 06:20

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3by5A00