Domain assigned by auto on 13 Oct 2008 17:25
Assigning to "2.40.380.10" based on similarity with "3cbtA01"
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|3bxtA01 GHWAPGSHILWRYRENGGPHVHIARPVTVVRDDADLLAVWLAPGTECVKPVLADGTPVHLEPLATRYTKPRTVQRDQWFG TGVLKLARPGEAWSVWLFWDPGWRFKNWYVNLERPLTRWEGGVDSEDHFLDISVHPDRTWHWRDEDEFAQALRDGLDPAS AGRVRRAGRSAVAEIRAWGSPFADGWEHWRPDPA
Assigning to "2.40.380.10" based on similarity with "3cbtA01"
No in_process hits for Domain "3bxtA01" ready to be processed
Domain "3bxtA01" hits Domain "3cbtA01" (99.4871794871795% over 100%) which is currently in process
Domain "3bxtA01" hits Domain "3cbtA01" (99.4871794871795% over 100%) which is currently in process
NW result present for Domain "3bxtA01"
All required files are present for Domain "3bxtA01"
Beginning processing for Domain "3bxtA01"
fine