Domain assigned by cuff on 11 Feb 2009 17:33
same superfamily
CATH Domain: 3bwwA01
3bwwA01
PDB 3bww, Chain A, Domain 1
Segment boundaries for domain 3bwwA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3bwwA01 | 0 | 205 |
| 3bwwA01 | 248 | 306 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.20.20.150.12.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
2q02A00 | 75.32 | 3.20.20.150 | 265 | 10 | 83 | 3.87 | 4.64 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|3bwwA01 GRQGAGLGYRRDLAEGFLQLRNNDRIQFEIAPENWIKGGFARYQFDKVAEKIPILIHGLSLSLGGQAPLDKELLSSIKAI KQYNTPFFSDHLSFLLPPFTDEAVKHTAARIREVQDFLEIQISVENTSYYLHSETSTNEVEFLNAIVQEANCGIHLDVNN IYVNAVNHGLLDPHVFIDNVDLKRVNYIHIAGTVWDLLEYTYARLSHPPTLLERFPPFEKLCKEVDIIHQLQQKYVKKRG LSWLKI
Domain COMBS Sequence
>pdb|3bwwA01 GXRQGAGLGYRRDLAEGFLQLRNNDRIQFXEIAPENWIKXGGFARYQFDKVAEKIPILIHGLSLSLGGQAPLDKELLSSI KAXIKQYNTPFFSDHLSFCECDGHLYDLLPXPFTDEAVKHTAARIREVQDFLEIQISVENTSYYLHSETSTXNEVEFLNA IVQEANCGIHLDVNNIYVNAVNHGLLDPHVFIDNVDLKRVNYIHIAGTVWDLLEYTYARLSHXPPTLLERDFNFPPFEKL CKEVDIIHQLQQKYVKKRGLSWLKI
Domain History Events (46)
Domain assignment manual match h by cuff on 11 Feb 2009 17:31
homology match
Homcheck allotment by cuff on 11 Feb 2009 17:29
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 11 Feb 2009 17:29
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 29 Nov 2008 09:34
Domain "3bwwA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 29 Nov 2008 09:33
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bwwA01
Flow stage update by auto on 29 Nov 2008 09:24
Retrieved PRC_PFAMCATH results for job ID SID5986811429731264 and results inserted.
Domain scan prc pfamcath by auto on 29 Nov 2008 09:23
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 19 results for 3bwwA01
Update comment by auto on 29 Nov 2008 06:27
PRC_PFAMCATH job SID5986811429731264 is not yet finished.
Flow stage update by auto on 29 Nov 2008 06:25
The entry "3bwwA01" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 29 Nov 2008 06:25
The entry "3bwwA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 29 Nov 2008 06:16
Retrieved SSAP results for job ID SID5523183948665536 and results inserted.
Domain scan ssap cath by auto on 29 Nov 2008 06:15
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 531 results for 3bwwA01
Update comment by auto on 27 Nov 2008 07:25
SSAP job SID5523183948665536 is not yet finished.
Ssap cath submit by auto on 27 Nov 2008 07:18
The entry "3bwwA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 27 Nov 2008 07:18
The entry "3bwwA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 27 Nov 2008 07:04
Retrieved PRC results for job ID SID4648371281087360 and inserted them into the database.
Domain scan prc cath by auto on 27 Nov 2008 07:04
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 3bwwA01
Prc cath submit by auto on 27 Nov 2008 06:35
The entry "3bwwA01" has been submitted to the PRC webservice.
Flow stage update by auto on 27 Nov 2008 06:35
The entry "3bwwA01" has been submitted to the PRC webservice.
Flow stage update by auto on 27 Nov 2008 06:17
Retrieved HMM(SAM) results for job ID SID6823883675061008 and inserted them into the database.
Domain scan sam cath by auto on 27 Nov 2008 06:17
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3bwwA01
Update comment by auto on 27 Nov 2008 03:41
HMM(SAM) job SID6823883675061008 is not yet finished.
Sam cath submit by auto on 27 Nov 2008 03:32
The entry "3bwwA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 27 Nov 2008 03:32
The entry "3bwwA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Nov 2008 23:41
Unable to retrieve "3bwwA01" HMM(SAM) results for job "SID1466126392166768"
Update comment by auto on 26 Nov 2008 20:39
HMM(SAM) job SID1466126392166768 is not yet finished.
Sam cath submit by auto on 26 Nov 2008 20:33
The entry "3bwwA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Nov 2008 20:33
The entry "3bwwA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Nov 2008 17:40
Unable to retrieve "3bwwA01" HMM(SAM) results for job "SID2139841283685456"
Update comment by auto on 26 Nov 2008 16:01
HMM(SAM) job SID2139841283685456 is not yet finished.
Flow stage update by auto on 26 Nov 2008 15:56
The entry "3bwwA01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 26 Nov 2008 15:56
The entry "3bwwA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 26 Nov 2008 15:41
Retrieved "3bwwA01" CATHEDRAL results for job ID SID9301801324509056 and inserted them into the database.
Domain scan cathedral cath by auto on 26 Nov 2008 15:40
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 142 results for 3bwwA01
Update comment by auto on 26 Nov 2008 11:48
"3bwwA01" CATHEDRAL job SID9301801324509056 is not yet finished.
Cathedral cath submit by auto on 26 Nov 2008 11:43
The entry "3bwwA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 26 Nov 2008 11:43
The entry "3bwwA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 26 Nov 2008 11:35
ScanList with 12333 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bwwA01.scanlist" for "3bwwA01"
Write scan list by auto on 26 Nov 2008 11:34
Writing ScanList containing 12333 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bwwA01.scanlist" for domain "3bwwA01"
Flow stage update by auto on 26 Nov 2008 11:24
No satisfactory AssignClose result found.
Flow stage update by auto on 26 Nov 2008 11:07
No in_process hits for Domain "3bwwA01" ready to be processed
Flow stage update by auto on 26 Nov 2008 11:07
NW result present for Domain "3bwwA01"
Flow stage update by auto on 20 Nov 2008 11:08
All required files are present for Domain "3bwwA01"
Flow stage update by auto on 19 Nov 2008 17:59
Beginning processing for Domain "3bwwA01"
Insertion by cuff on 19 Nov 2008 17:23
nice chopping
