CATH Domain: 3bwhA02 XML data for domain: 3bwhA02

Molscript image for 3bwhA02
3bwhA02
PDB coordinates for domain 3bwhA02

PDB 3bwh, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.470 Ricin (A Subunit), domain 2
4.10.470.10 Ricin (A Subunit), domain 2 Gene3D
4.10.470.10.1
4.10.470.10.1.1
4.10.470.10.1.1.1
4.10.470.10.1.1.1.1
4.10.470.10.1.1.1.1.1

[top]
Segment boundaries for domain 3bwhA02

Chopping figure for domain 3bwhA02
DomainStart PDB ResidueStop PDB Residue
3bwhA01 1 160
3bwhA02 161 244

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 4.10.470.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1abrA02 92.30 RRNA N-glycosylase activityAbrus precatoriusAbrin-aGalactose bindingNegative regulation of translation 4.10.470.10 85 30 95 2.11 2.21
3ktzA02 91.64 Ribosome-inactivating protein geloninGelonium multiflorum 4.10.470.10 83 37 96 1.85 1.92
1m2tA02 91.31 Beta-galactoside-specific lectin 1Viscum album 4.10.470.10 81 27 94 1.71 1.82
2vc4A02 90.42 Ricinus communisRicin 4.10.470.10 88 28 90 2.27 2.50
2z4uA02 90.41 RRNA N-glycosylase activityPhytolacca dioicaDefense responseRibosome-inactivating protein PD-L3/PD-L4Negative regulation of translation 4.10.470.10 81 32 95 2.38 2.50
1hwmA02 89.74 Sambucus ebulusRibosome-inactivating protein 4.10.470.10 86 28 97 2.53 2.59
1llnA02 82.62 Antiviral protein 2Phytolacca americana 4.10.470.10 81 19 91 3.69 4.03
1rl0A02 82.57 Dianthus caryophyllusAntiviral protein DAP-30 4.10.470.10 74 18 85 3.43 4.00
3hisA02 82.54 Saponaria officinalisSaporin-L3 4.10.470.10 81 30 92 4.50 4.85
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bwhA02
RFRYIELQIANNVGTKFKPSQTIISLENNWSALSKQIQIAKNKNGQFETPVILIDPQGNRVQITNVTSNVVTQNIQLLLN
IGAT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bwhA02
RFRYIELQIANNVGTKFKPSQTIISLENNWSALSKQIQIAKNKNGQFETPVILIDPQGNRVQITNVTSNVVTQNIQLLLN
IGATA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 12 Oct 2008 23:44

Assigning to "4.10.470.10" based on similarity with "1gisA02"

Flow stage update by auto on 12 Oct 2008 23:14

No in_process hits for Domain "3bwhA02" ready to be processed

Flow stage update by auto on 12 Oct 2008 23:14

NW result present for Domain "3bwhA02"

Flow stage update by auto on 11 Oct 2008 08:41

All required files are present for Domain "3bwhA02"

Flow stage update by auto on 10 Oct 2008 11:17

Beginning processing for Domain "3bwhA02"

Insertion by auto on 10 Oct 2008 11:14

Final ChopClose added based on similarity with "1cf5A"