CATH Domain: 3bwhA01 XML data for domain: 3bwhA01

Molscript image for 3bwhA01
3bwhA01
PDB coordinates for domain 3bwhA01

PDB 3bwh, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.420 Ricin (A subunit); domain 1
3.40.420.10 Ricin (A subunit), domain 1 Gene3D
3.40.420.10.1
3.40.420.10.1.1
3.40.420.10.1.1.1
3.40.420.10.1.1.1.1
3.40.420.10.1.1.1.1.1

[top]
Segment boundaries for domain 3bwhA01

Chopping figure for domain 3bwhA01
DomainStart PDB ResidueStop PDB Residue
3bwhA01 1 160
3bwhA02 161 244

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.40.420.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1abrA01 91.76 RRNA N-glycosylase activityAbrus precatoriusAbrin-aGalactose bindingNegative regulation of translation 3.40.420.10 166 43 95 1.34 1.40
3ktzA01 91.66 Ribosome-inactivating protein geloninGelonium multiflorum 3.40.420.10 168 38 94 1.11 1.17
2vc4A01 91.55 Ricinus communisRicin 3.40.420.10 175 38 91 1.31 1.43
2z4uA01 88.63 RRNA N-glycosylase activityPhytolacca dioicaDefense responseRibosome-inactivating protein PD-L3/PD-L4Negative regulation of translation 3.40.420.10 177 27 89 1.73 1.93
3hisA01 87.96 Saponaria officinalisSaporin-L3 3.40.420.10 176 26 89 2.06 2.29
1r4pA01 86.39 Pathogenic Escherichia coli infectionShiga toxin subunit AShiga-like toxin 2 subunit AEnterobacteria phage 933W 3.40.420.10 170 17 89 2.31 2.58
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bwhA01
NVRFDLSSATSSSYKTFIKNLREALPKDGKVYDIPVLLSTVMDSRRFILIDLVNYDGQSITAAIDVLNVYIVAYSTGTVS
YFFQQVPAQAPKLLFKGTQQRTLPYTGNYENLQTAAKKLRENIELGLPALDSAITTLFHYNAEAAASALLVLIQTTSEAA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bwhA01
NVRFDLSSATSSSYKTFIKNLREALPKDGKVYDIPVLLSTVMDSRRFILIDLVNYDGQSITAAIDVLNVYIVAYSTGTVS
YFFQQVPAQAPKLLFKGTQQRTLPYTGNYENLQTAAKKLRENIELGLPALDSAITTLFHYNAEAAASALLVLIQTTSEAA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 12 Oct 2008 23:44

Assigning to "3.40.420.10" based on similarity with "1cf5A01"

Flow stage update by auto on 12 Oct 2008 23:14

No in_process hits for Domain "3bwhA01" ready to be processed

Flow stage update by auto on 12 Oct 2008 23:14

NW result present for Domain "3bwhA01"

Flow stage update by auto on 11 Oct 2008 08:41

All required files are present for Domain "3bwhA01"

Flow stage update by auto on 10 Oct 2008 11:17

Beginning processing for Domain "3bwhA01"

Insertion by auto on 10 Oct 2008 11:14

Final ChopClose added based on similarity with "1cf5A"