CATH Domain: 3bwgC02 XML data for domain: 3bwgC02

Molscript image for 3bwgC02
3bwgC02
PDB coordinates for domain 3bwgC02

PDB 3bwg, Chain C, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1410 Chorismate lyase
3.40.1410.10 Chorismate lyase Gene3D
3.40.1410.10.6
3.40.1410.10.6.1
3.40.1410.10.6.1.1
3.40.1410.10.6.1.1.1
3.40.1410.10.6.1.1.1.1

[top]
Segment boundaries for domain 3bwgC02

Chopping figure for domain 3bwgC02
DomainStart PDB ResidueStop PDB Residue
3bwgC01 3 70
3bwgC02 71 233

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.40.1410.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ddvB01 89.03 GntR family transcriptional regulatorTranscriptional regulator, GntR familyEnterococcus faecalis 3.40.1410.10 137 25 87 1.70 1.94
2pkhB01 86.22 Pseudomonas syringae pv. tomatoHistidine utilization repressorGntR family transcriptional regulator, histidine utilization repressor 3.40.1410.10 129 15 82 1.69 2.05
2p19A01 86.22 Corynebacterium glutamicumBacterial regulatory proteins, gntR family 3.40.1410.10 130 16 82 1.58 1.91
2oggA01 85.42 GntR family transcriptional regulator, trehalose operon transcriptional repressorBacillus subtilisTrehalose operon transcriptional repressor 3.40.1410.10 133 24 85 2.17 2.55
3eetB02 84.14 Streptomyces avermitilisPutative GntR-family transcriptional regulator 3.40.1410.10 161 12 90 2.95 3.28
2nwiB00 82.98 Archaeoglobus fulgidusPutative uncharacterized protein 3.40.1410.10 151 11 89 3.60 4.01
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bwgC02
RKGYISLLSLEDFNVTSKVIELDVRKPTPEAAENLNIGDEDIYYVKRVRYINGQTLCYEESYYTKSIVTYLNNEIVSHSI
FHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIESIFHLTNGQPFDYSKISYNYEQSQFVVQANS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bwgC02
RKGYISLLSNQGFKKDLEDFNVTSKVIELDVRKPTPEAAENLNIGXDEDIYYVKRVRYINGQTLCYEESYYTKSIVTYLN
NEIVSHSIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIESIFHLTNGQPFDYSKISYNYEQSQFVVQ
ANSFLL
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 26 Nov 2008 14:38

Assigning to "3.40.1410.10" based on similarity with "3bwgA02"

Flow stage update by auto on 26 Nov 2008 14:36

No in_process hits for Domain "3bwgC02" ready to be processed

Update comment by auto on 26 Nov 2008 14:23

Domain "3bwgC02" hits Domain "3bwgB02" (99.3975903614458% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 11:09

Domain "3bwgC02" hits Domain "3bwgA02" (99.3975903614458% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

Domain "3bwgC02" hits Domain "3bwgA02" (99.3975903614458% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

NW result present for Domain "3bwgC02"

Flow stage update by auto on 21 Nov 2008 11:22

All required files are present for Domain "3bwgC02"

Flow stage update by auto on 20 Nov 2008 23:38

Beginning processing for Domain "3bwgC02"

Insertion by auto on 20 Nov 2008 23:11

Final ChopClose added based on similarity with "3bwgA"