CATH Domain: 3bw6A00 XML data for domain: 3bw6A00

Molscript image for 3bw6A00
3bw6A00
PDB coordinates for domain 3bw6A00

PDB 3bw6, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.50 Gene3D
3.30.450.50.1
3.30.450.50.1.1
3.30.450.50.1.1.1
3.30.450.50.1.1.1.1
3.30.450.50.1.1.1.1.1

[top]
Segment boundaries for domain 3bw6A00

Chopping figure for domain 3bw6A00
DomainStart PDB ResidueStop PDB Residue
3bw6A00 -1 135

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.450.50.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ifqB00 86.25 SNARE interactions in vesicular transportMus musculusVesicle-trafficking protein SEC22bGolgi membraneEndoplasmic reticulum membrane 3.30.450.50 125 16 88 2.10 2.38
2j3wA00 83.91 Mus musculusTrafficking protein particle complex subunit 2 3.30.450.70 142 7 92 3.10 3.33
2vglS00 81.25 Huntington's diseaseEndocytosisMus musculusAP-2 complex subunit sigmaAP-2 complex subunit sigma-1 3.30.450.60 142 8 85 3.59 4.21
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bw6A00
MAMRIYYIGVFRSGGEKALELSEVKDLSQFGFFERSSVGQFMTFFAETVASRTGAGQRQSIEEGNYIGHVYARSEGICGV
LITDKEYPVRPAYTLLNKILDEYLVAHPKEEWADVTETNDALKMKQLDTYISKYQDP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bw6A00
GAMAMRIYYIGVFRSGGEKALELSEVKDLSQFGFFERSSVGQFMTFFAETVASRTGAGQRQSIEEGNYIGHVYARSEGIC
GVLITDKEYPVRPAYTLLNKILDEYLVAHPKEEWADVTETNDALKMKQLDTYISKYQDPSQADA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 06 Apr 2008 11:20

Assigning to "3.30.450.50" based on similarity with "1h8mA00"

Flow stage update by auto on 06 Apr 2008 11:05

No in_process hits for Domain "3bw6A00" ready to be processed

Flow stage update by auto on 06 Apr 2008 11:05

NW result present for Domain "3bw6A00"

Flow stage update by auto on 05 Apr 2008 08:22

All required files are present for Domain "3bw6A00"

Flow stage update by auto on 05 Apr 2008 04:00

Beginning processing for Domain "3bw6A00"

Insertion by auto on 05 Apr 2008 02:23

Final ChopClose added based on similarity with "1h8mA"