CATH Domain: 3bvxA01 XML data for domain: 3bvxA01

Molscript image for 3bvxA01
3bvxA01
PDB coordinates for domain 3bvxA01

PDB 3bvx, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.110 7-stranded beta/alpha barrel
3.20.110.10 Glycoside hydrolase 38, N terminal domain Gene3D
3.20.110.10.1
3.20.110.10.1.1
3.20.110.10.1.1.1
3.20.110.10.1.1.1.1
3.20.110.10.1.1.1.1.1

[top]
Segment boundaries for domain 3bvxA01

Chopping figure for domain 3bvxA01
DomainStart PDB ResidueStop PDB Residue
3bvxA01 30 411
3bvxA02 412 522
3bvxA03 523 647
3bvxA03 928 949
3bvxA04 648 927
3bvxA05 950 1045

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.20.110.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1o7dA01 83.98 Lysosomal alpha-mannosidase [EC:3.2.1.24]LysosomeBos taurusLysosomal alpha-mannosidaseOther glycan degradation 3.20.110.10 279 26 68 1.62 2.36
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bvxA01
QCQDVVQDVPNVDVQMLELYDRMSFKDIDGGVWKQGWNIKYDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEEYYQHDTKH
ILSNALRHLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWL
KQFMNVTPTASWAIAPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQIWDNKGDTALFTHMMPFYSY
DIPHTCGPDPKVCCQFDFKRMGSFGLSCPWKVPPRTISDQNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTE
WDVQRVNYERLFEHINSQAHFNVQAQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTYADRS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bvxA01
QCQDVVQDVPNVDVQMLELYDRMSFKDIDGGVWKQGWNIKYDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEEYYQHDTKH
ILSNALRHLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWL
KQFMNVTPTASWAIAPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQIWDNKGDTALFTHMMPFYSY
DIPHTCGPDPKVCCQFDFKRMGSFGLSCPWKVPPRTISDQNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTE
WDVQRVNYERLFEHINSQAHFNVQAQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTYADRS
BLAST against CATH

[top]
Domain History Events (14)

Domain assigned by auto on 29 Jul 2008 09:36

Assigning to "3.20.110.10" based on similarity with "3budA01"

Flow stage update by auto on 29 Jul 2008 09:36

No in_process hits for Domain "3bvxA01" ready to be processed

Update comment by auto on 29 Jul 2008 09:33

Domain "3bvxA01" hits Domain "3bvuA01" (100% over 99.738219895288%) which is currently in process

Update comment by auto on 29 Jul 2008 09:30

Domain "3bvxA01" hits Domain "3bvwA01" (100% over 99.738219895288%) which is currently in process

Update comment by auto on 29 Jul 2008 09:27

Domain "3bvxA01" hits Domain "3bvtA01" (100% over 100%) which is currently in process

Update comment by auto on 29 Jul 2008 09:16

Domain "3bvxA01" hits Domain "3bvvA01" (100% over 100%) which is currently in process

Update comment by auto on 29 Jul 2008 09:05

Domain "3bvxA01" hits Domain "3bupA01" (99.4750656167979% over 99.738219895288%) which is currently in process

Update comment by auto on 29 Jul 2008 08:49

Domain "3bvxA01" hits Domain "3buqA01" (100% over 100%) which is currently in process

Update comment by auto on 29 Jul 2008 05:50

Domain "3bvxA01" hits Domain "3buiA01" (100% over 100%) which is currently in process

Flow stage update by auto on 29 Jul 2008 05:26

Domain "3bvxA01" hits Domain "3buiA01" (100% over 100%) which is currently in process

Flow stage update by auto on 29 Jul 2008 05:26

NW result present for Domain "3bvxA01"

Flow stage update by auto on 26 Jul 2008 11:49

All required files are present for Domain "3bvxA01"

Flow stage update by auto on 26 Jul 2008 11:49

Beginning processing for Domain "3bvxA01"

Insertion by auto on 26 Jul 2008 03:29

Final ChopClose added based on similarity with "3budA"