CATH Domain: 3bvoB01 XML data for domain: 3bvoB01

Molscript image for 3bvoB01
3bvoB01
PDB coordinates for domain 3bvoB01

PDB 3bvo, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.287 Helix Hairpins
1.10.287.110 Gene3D
1.10.287.110.5
1.10.287.110.5.1
1.10.287.110.5.1.1
1.10.287.110.5.1.1.1
1.10.287.110.5.1.1.1.1

[top]
Segment boundaries for domain 3bvoB01

Chopping figure for domain 3bvoB01
DomainStart PDB ResidueStop PDB Residue
3bvoB01 40 143
3bvoB02 156 234

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 1.10.287.110.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gaxA05 76.58 Aminoacyl-tRNA biosynthesisValyl-tRNA synthetase [EC:6.1.1.9]Valyl-tRNA synthetaseValine, leucine and isoleucine biosynthesisThermus thermophilus 1.10.287.380 73 4 55 2.64 4.74
1iurA01 76.27 DendriteCell body fiberNucleusHsp70 protein bindingNegative regulation of inclusion body assembly 1.10.287.110 63 9 64 3.20 4.93
1skvA00 75.70 Protein D-63Sulfolobus virus 1 1.10.287.660 62 6 50 2.11 4.18
1vq8V00 75.65 RibosomeLarge subunit ribosomal protein L29Haloarcula marismortui50S ribosomal protein L29P 1.10.287.310 65 3 56 2.71 4.78
2fb5A01 75.61 Bacillus cereus ATCC 14579Hypothetical Membrane Spanning Protein 1.10.287.770 72 2 55 2.69 4.83
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bvoB01
RCWNCGGEDRFFCPQCRALQAPDPTRDYFSLDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVND
AYKTLLAPLSRGLYLLK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bvoB01
SAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLXDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQ
RSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLK
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 18 Feb 2009 18:45

Assigning to "1.10.287.110" based on similarity with "3bvoA01"

Flow stage update by auto on 18 Feb 2009 18:16

No in_process hits for Domain "3bvoB01" ready to be processed

Update comment by auto on 26 Nov 2008 11:09

Domain "3bvoB01" hits Domain "3bvoA01" (99.1304347826087% over 95.0413223140496%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

Domain "3bvoB01" hits Domain "3bvoA01" (99.1304347826087% over 95.0413223140496%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

NW result present for Domain "3bvoB01"

Flow stage update by auto on 21 Nov 2008 11:22

All required files are present for Domain "3bvoB01"

Flow stage update by auto on 20 Nov 2008 23:38

Beginning processing for Domain "3bvoB01"

Insertion by auto on 20 Nov 2008 23:08

Final ChopClose added based on similarity with "3bvoA"