CATH Domain: 3bvfA00 XML data for domain: 3bvfA00

Molscript image for 3bvfA00
3bvfA00
PDB coordinates for domain 3bvfA00

PDB 3bvf, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.6
1.20.1260.10.6.1
1.20.1260.10.6.1.1
1.20.1260.10.6.1.1.1
1.20.1260.10.6.1.1.1.1

[top]
Segment boundaries for domain 3bvfA00

Chopping figure for domain 3bvfA00
DomainStart PDB ResidueStop PDB Residue
3bvfA00 1005 166

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vlgA00 91.36 Porphyrin and chlorophyll metabolismThermotoga maritimaFerritin [EC:1.16.3.1]Ferritin 1.20.1260.10 164 29 90 1.53 1.68
3a9qE00 88.86 Ferritin-4, chloroplasticGlycine max 1.20.1260.10 168 19 86 1.89 2.17
3fvbA00 88.45 BacterioferritinBrucella melitensis biovar Abortus 2308Bacterioferritin 1.20.1260.10 161 14 91 3.43 3.73
1nfvA00 86.78 BacterioferritinBacterioferritinDesulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 1.20.1260.10 169 12 89 3.81 4.24
1lkoA01 84.90 Desulfovibrio vulgaris str. HildenboroughIron ion bindingRubrerythrin 1.20.1260.10 145 14 82 3.41 4.15
2qqyA00 83.70 Bacillus anthracisBacterioferritinPutative uncharacterized protein 1.20.1260.10 133 13 79 3.02 3.79
1jigA00 83.60 Bacillus anthracisStarvation-inducible DNA-binding proteinDNA protection during starvation protein 1 1.20.1260.10 146 8 79 2.85 3.58
2ib0A01 83.44 Mycobacterium tuberculosisCONSERVED HYPOTHETICAL ALANINE RICH PROTEIN 1.20.1260.10 135 12 77 2.92 3.79
3kwoA00 82.73 DNA protection during starvation proteinCampylobacter jejuniStarvation-inducible DNA-binding proteinProtein binding 1.20.1260.10 144 9 79 3.35 4.21
2yw6B00 82.62 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 8 82 3.52 4.25
2oh3A01 81.67 Magnetospirillum magneticum AMB-1Uncharacterized conserved protein 1.20.1260.10 132 9 72 3.57 4.92
2qf9A01 77.31 Putative secreted proteinStreptomyces coelicolor 1.20.1260.10 140 7 76 3.56 4.66
[1]
Displaying entries 1 to 12 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bvfA00
HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSIS
APEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLA
DQYVKGIAKSRK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bvfA00
MGSSHHHHHHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNV
PVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGN
ENHGLYLADQYVKGIAKSRKS
BLAST against CATH

[top]
Domain History Events (14)

Domain assigned by auto on 20 Jan 2009 21:29

Assigning to "1.20.1260.10" based on similarity with "3bviC00"

Flow stage update by auto on 20 Jan 2009 21:29

No in_process hits for Domain "3bvfA00" ready to be processed

Update comment by auto on 20 Jan 2009 21:26

Domain "3bvfA00" hits Domain "3bveF00" (100% over 100%) which is currently in process

Update comment by auto on 20 Jan 2009 21:23

Domain "3bvfA00" hits Domain "3bveE00" (100% over 100%) which is currently in process

Update comment by auto on 20 Jan 2009 21:20

Domain "3bvfA00" hits Domain "3bviB00" (100% over 100%) which is currently in process

Update comment by auto on 20 Jan 2009 21:12

Domain "3bvfA00" hits Domain "3bviC00" (100% over 100%) which is currently in process

Update comment by auto on 20 Jan 2009 21:09

Domain "3bvfA00" hits Domain "3bvfB00" (100% over 100%) which is currently in process

Update comment by auto on 20 Jan 2009 21:03

Domain "3bvfA00" hits Domain "3bviF00" (100% over 100%) which is currently in process

Update comment by auto on 20 Jan 2009 20:51

Domain "3bvfA00" hits Domain "3bvkF00" (100% over 100%) which is currently in process

Flow stage update by auto on 20 Jan 2009 20:38

Domain "3bvfA00" hits Domain "3bvkF00" (100% over 100%) which is currently in process

Flow stage update by auto on 20 Jan 2009 20:38

NW result present for Domain "3bvfA00"

Flow stage update by auto on 20 Jan 2009 10:29

All required files are present for Domain "3bvfA00"

Flow stage update by auto on 19 Jan 2009 15:51

Beginning processing for Domain "3bvfA00"

Insertion by auto on 19 Jan 2009 14:59

Final ChopClose added based on similarity with "3bveA"