CATH Domain: 3bv8A00

3bv8A00

PDB 3bv8, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.70	Alpha-Beta Plaits
3.30.70.250		Gene3D
3.30.70.250.4
3.30.70.250.4.1
3.30.70.250.4.1.1
3.30.70.250.4.1.1.1
3.30.70.250.4.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3bv8A00

Domain	Start PDB Residue	Stop PDB Residue
3bv8A00	4	88

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (20 entries)

There are 20 matching structural neighberhood comparisons for CATH ID 3.30.70.250.4.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
1s99A01	78.14	Bacillus subtilisPutative HMP/thiamine-binding protein ykoF	3.30.70.930	77	5	69	2.91	4.21
1q5yD00	78.04	CopG family transcriptional regulator, nickel-responsive regulatorNickel-responsive regulatorProtein bindingEscherichia coli K-12	3.30.70.1150	80	3	72	2.61	3.59
2f1fA01	77.24	Valine, leucine and isoleucine biosynthesisMetabolic pathwaysButanoate metabolismC5-Branched dibasic acid metabolismPantothenate and CoA biosynthesis	3.30.70.260	79	1	69	3.28	4.75
1yx2A02	77.07	Nitrogen metabolismAminomethyltransferase [EC:2.1.2.10]One carbon pool by folateBacillus subtilisGlycine, serine and threonine metabolism	3.30.70.1400	81	7	63	2.98	4.72
1y7pB01	76.83	Archaeoglobus fulgidusUncharacterized protein AF_1403	3.30.70.260	80	7	67	2.49	3.67
1u7lA01	76.57	V-type H+-transporting ATPase subunit C [EC:3.6.3.14]Oxidative phosphorylationVacuolar acidificationProtein bindingVacuolar proton-transporting V-type ATPase, V1 domain	3.30.70.1180	91	7	65	2.96	4.49
2qmxA03	76.33	Prephenate dehydratase [EC:4.2.1.51]Phenylalanine, tyrosine and tryptophan biosynthesisChlorobaculum tepidumMetabolic pathwaysPrephenate dehydratase	3.30.70.260	90	3	75	3.41	4.51
2fb0A00	76.26	Bacteroides thetaiotaomicronPutative uncharacterized protein	3.30.70.900	91	7	63	2.87	4.50
1s99A02	76.06	Bacillus subtilisPutative HMP/thiamine-binding protein ykoF	3.30.70.930	81	9	72	3.60	4.96
2nyiA02	75.55		3.30.70.260	89	7	66	3.08	4.65
1vjqA00	75.51		3.30.70.340	71	11	69	3.20	4.63
2nzcA00	75.20	Thermotoga maritimaPutative uncharacterized protein	3.30.70.1150	77	5	64	2.75	4.28
1cvjA01	75.18	Poly(A) RNA bindingTranslation activator activityProtein C-terminus bindingMRNA polyadenylationPolyadenylate-binding protein 1	3.30.70.330	77	5	63	3.04	4.82
1u8sA02	75.14	Glycine cleavage system transcriptional repressor, putativeGlycine cleavage system transcriptional repressorVibrio cholerae	3.30.70.260	84	4	69	3.05	4.42
1in0A01	74.89	Hypothetical proteinHaemophilus influenzaeUPF0234 protein HI_1034	3.30.70.860	70	10	63	2.71	4.30
1kn6A00	74.65	Mus musculusPeptide hormone processingSerine-type endopeptidase activityNeuroendocrine convertase 1Proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]	3.30.70.850	73	6	65	2.92	4.46
1wj9A01	74.06	Thermus thermophilus HB8Putative uncharacterized protein TTHB192	3.30.70.1200	87	3	62	3.01	4.85
2qmwA03	73.79	Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysPrephenate dehydratase [EC:4.2.1.51]Similar to chorismate mutaseStaphylococcus aureus subsp. aureus Mu50	3.30.70.260	73	5	63	2.93	4.64
2fiuA00	73.61	Agrobacterium tumefaciens str. C58Putative uncharacterized protein	3.30.70.900	93	7	63	3.06	4.82
1jqgA01	73.28	Carboxypeptidase AHelicoverpa armigera	3.30.70.340	91	4	79	3.74	4.73

[top]
Domain ATOM Sequence

>pdb|3bv8A00
ALTAEEIIQYISDAKKFTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKPFYEAYGSQFEDIEIEDRRNSAIP
LKDL

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3bv8A00
SNALTAEEIIQYISDAKKFTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKPFYEAYGSQFEDIEIEXDRRNS
AIPLKDL

BLAST against CATH

[top]
Domain History Events (46)

Domain assigned by cuff on 23 Feb 2009 11:30

homology match

Domain assignment manual match h by cuff on 23 Feb 2009 11:29

nice structural match, same function

Homcheck allotment by cuff on 11 Feb 2009 17:11

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 11 Feb 2009 17:11

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Nov 2008 01:05

Domain "3bv8A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Nov 2008 01:05

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bv8A00

Flow stage update by auto on 28 Nov 2008 00:38

Retrieved PRC_PFAMCATH results for job ID SID3441831311872952 and results inserted.

Domain scan prc pfamcath by auto on 28 Nov 2008 00:37

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 3bv8A00

Update comment by auto on 27 Nov 2008 22:12

PRC_PFAMCATH job SID3441831311872952 is not yet finished.

Flow stage update by auto on 27 Nov 2008 22:10

The entry "3bv8A00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 27 Nov 2008 22:10

The entry "3bv8A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Nov 2008 21:54

Retrieved SSAP results for job ID SID3140065649871216 and results inserted.

Domain scan ssap cath by auto on 27 Nov 2008 21:51

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2970 results for 3bv8A00

Update comment by auto on 27 Nov 2008 07:24

SSAP job SID3140065649871216 is not yet finished.

Ssap cath submit by auto on 27 Nov 2008 07:18

The entry "3bv8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 27 Nov 2008 07:18

The entry "3bv8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 27 Nov 2008 07:01

Retrieved PRC results for job ID SID6956770736843040 and inserted them into the database.

Domain scan prc cath by auto on 27 Nov 2008 07:01

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 3bv8A00

Prc cath submit by auto on 27 Nov 2008 06:34

The entry "3bv8A00" has been submitted to the PRC webservice.

Flow stage update by auto on 27 Nov 2008 06:34

The entry "3bv8A00" has been submitted to the PRC webservice.

Flow stage update by auto on 27 Nov 2008 06:14

Retrieved HMM(SAM) results for job ID SID8717142717360448 and inserted them into the database.

Domain scan sam cath by auto on 27 Nov 2008 06:14

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3bv8A00