Domain assigned by cuff on 25 Feb 2009 18:23
homology match
CATH Domain: 3bv6A00
3bv6A00
PDB 3bv6, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|3bv6A00 KVNEITRESWILSTFPEWGTWLNEEIEQTVVEPNTFSMWWLGCTGIWLKSAGNTNLSIDFWCGTGKKTQKNRLMNTQHQM MRMGGVEALQPNLRTSIFPLDPFAIKEIDAVLASHDHADHIDVNVAAAVLQNCGEHVKFIGPQACVDLWLGWGVPQERCI VAKVGDVLEIGDVKIRVLDSFDRTALVTLPKGVSSYDKAILDGMDERAVNYLIETSGGSVYHSGDSHYSNYYAKHGNDYQ IDVALLSYGENPRGVTDKMTSSDVLRAAESLDCQVVVPFHHDIWANFQNDPREIEVLWNMKKDRLQYQFAPFFWQVGGKY TYPTDKGRMHYQHFRGFQDIFKNEPELPYKAFL
Domain COMBS Sequence
>pdb|3bv6A00 KVNEITRESWILSTFPEWGTWLNEEIEQTVVEPNTFSMWWLGCTGIWLKSAGNTNLSIDFWCGTGKKTQKNRLMNTQHQM MRMGGVEALQPNLRTSIFPLDPFAIKEIDAVLASHDHADHIDVNVAAAVLQNCGEHVKFIGPQACVDLWLGWGVPQERCI VAKVGDVLEIGDVKIRVLDSFDRTALVTLPKGVSSYDKAILDGMDERAVNYLIETSGGSVYHSGDSHYSNYYAKHGNDYQ IDVALLSYGENPRGVTDKMTSSDVLRAAESLDCQVVVPFHHDIWANFQNDPREIEVLWNMKKDRLQYQFAPFFWQVGGKY TYPTDKGRMHYQHFRGFQDIFKNEPELPYKAFL
Domain History Events (43)
Domain assignment manual match h by cuff on 25 Feb 2009 18:21
homology match
Homcheck allotment by cuff on 11 Feb 2009 17:06
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 11 Feb 2009 17:06
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 30 Nov 2008 23:39
Domain "3bv6A00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 30 Nov 2008 23:39
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bv6A00
Flow stage update by auto on 30 Nov 2008 23:38
Retrieved PRC_PFAMCATH results for job ID SID1583154866415680 and results inserted.
Domain scan prc pfamcath by auto on 30 Nov 2008 23:37
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 41 results for 3bv6A00
Flow stage update by auto on 30 Nov 2008 22:06
The entry "3bv6A00" has been submitted to the PRC_PFAMCATH webservice.
Update comment by auto on 30 Nov 2008 22:06
PRC_PFAMCATH job SID1583154866415680 is not yet finished.
Prc pfamcath submit by auto on 30 Nov 2008 22:06
The entry "3bv6A00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 30 Nov 2008 22:05
Retrieved SSAP results for job ID SID6062290840240640 and results inserted.
Domain scan ssap cath by auto on 30 Nov 2008 22:05
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 26 results for 3bv6A00
Update comment by auto on 28 Nov 2008 03:53
SSAP job SID6062290840240640 is not yet finished.
Flow stage update by auto on 28 Nov 2008 03:31
The entry "3bv6A00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 28 Nov 2008 03:31
The entry "3bv6A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 28 Nov 2008 03:30
Retrieved PRC results for job ID SID1213978831956000 and inserted them into the database.
Domain scan prc cath by auto on 28 Nov 2008 03:29
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 23 results for 3bv6A00
Flow stage update by auto on 27 Nov 2008 23:29
The entry "3bv6A00" has been submitted to the PRC webservice.
Update comment by auto on 27 Nov 2008 23:29
PRC job SID1213978831956000 is not yet finished.
Flow stage update by auto on 27 Nov 2008 23:29
Retrieved HMM(SAM) results for job ID SID5610857103039404 and inserted them into the database.
Prc cath submit by auto on 27 Nov 2008 23:29
The entry "3bv6A00" has been submitted to the PRC webservice.
Domain scan sam cath by auto on 27 Nov 2008 23:28
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 15 results for 3bv6A00
Update comment by auto on 27 Nov 2008 09:15
HMM(SAM) job SID5610857103039404 is not yet finished.
Flow stage update by auto on 27 Nov 2008 09:15
The entry "3bv6A00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 27 Nov 2008 09:15
The entry "3bv6A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 27 Nov 2008 09:14
Retrieved "3bv6A00" CATHEDRAL results for job ID SID2178189107813440 and inserted them into the database.
Domain scan cathedral cath by auto on 27 Nov 2008 09:12
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 617 results for 3bv6A00
Update comment by auto on 26 Nov 2008 23:37
"3bv6A00" CATHEDRAL job SID2178189107813440 is not yet finished.
Flow stage update by auto on 26 Nov 2008 23:37
The entry "3bv6A00" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 26 Nov 2008 23:36
The entry "3bv6A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 26 Nov 2008 20:26
Unable to retrieve "3bv6A00" CATHEDRAL results for job "SID1767708107457496"
Update comment by auto on 26 Nov 2008 11:48
"3bv6A00" CATHEDRAL job SID1767708107457496 is not yet finished.
Cathedral cath submit by auto on 26 Nov 2008 11:42
The entry "3bv6A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 26 Nov 2008 11:42
The entry "3bv6A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 26 Nov 2008 11:34
ScanList with 12333 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bv6A00.scanlist" for "3bv6A00"
Write scan list by auto on 26 Nov 2008 11:33
Writing ScanList containing 12333 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bv6A00.scanlist" for domain "3bv6A00"
Flow stage update by auto on 26 Nov 2008 11:23
No satisfactory AssignClose result found.
Flow stage update by auto on 26 Nov 2008 11:07
No in_process hits for Domain "3bv6A00" ready to be processed
Flow stage update by auto on 26 Nov 2008 11:07
NW result present for Domain "3bv6A00"
Flow stage update by auto on 21 Nov 2008 11:22
All required files are present for Domain "3bv6A00"
Flow stage update by auto on 20 Nov 2008 23:38
Beginning processing for Domain "3bv6A00"
Insertion by cuff on 20 Nov 2008 15:50
nice chopping
