CATH Domain: 3buxB03 XML data for domain: 3buxB03

Molscript image for 3buxB03
3buxB03
PDB coordinates for domain 3buxB03

PDB 3bux, Chain B, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.8
3.30.505.10.8.1
3.30.505.10.8.1.1
3.30.505.10.8.1.1.1
3.30.505.10.8.1.1.1.1

[top]
Segment boundaries for domain 3buxB03

Chopping figure for domain 3buxB03
DomainStart PDB ResidueStop PDB Residue
3buxB01 47 175
3buxB02 176 264
3buxB03 265 350

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 3.30.505.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 14 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2oq1A03 83.93 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 99 13 77 2.51 3.23
2shpA02 83.83 Tyrosine-protein phosphatase non-receptor type 11Homo sapiens 3.30.505.10 101 15 74 2.17 2.92
1i3zA00 82.94 Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding 3.30.505.10 102 16 74 2.19 2.94
1ayaA00 82.59 Hormone-mediated signaling pathwayRegulation of multicellular organism growthNerve growth factor receptor signaling pathwayTriglyceride metabolic processNegative regulation of insulin secretion 3.30.505.10 101 12 75 2.42 3.22
1qadA00 82.08 Jak-STAT signaling pathwayAldosterone-regulated sodium reabsorptionNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathway 3.30.505.10 104 10 69 2.11 3.05
2dm0A01 82.01 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 12 75 2.22 2.95
2crhA01 82.00 Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis 3.30.505.10 102 11 72 2.48 3.42
1ju5A00 81.54 Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway 3.30.505.10 109 18 68 2.23 3.24
2iugA00 80.79 ErbB-3 class receptor bindingInsulin-like growth factor receptor signaling pathwayInsulin receptor signaling pathwayGrowth hormone receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 110 15 71 3.37 4.69
1milA00 80.43 Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 104 16 73 3.32 4.54
1uurA04 79.55 Protein homodimerization activityNucleusSignal transducer and activator of transcription APositive regulation of transcriptionCytosol 3.30.505.10 132 18 61 1.86 3.03
2pldA00 77.74 Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway 3.30.505.10 105 13 74 3.09 4.16
1bg1A04 75.75 Positive regulation of transcription from RNA polymerase II promoterTemperature homeostasisRegulation of multicellular organism growthNucleusPlasma membrane 3.30.505.10 109 12 70 3.08 4.36
1bf5A04 74.75 Jak-STAT signaling pathwayPathways in cancerChemokine signaling pathwayNucleolusProtein binding 3.30.505.10 112 11 68 3.08 4.48
[1]
Displaying entries 1 to 14 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3buxB03
HPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRN
QNPDLT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3buxB03
HPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRN
QNPDLT
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 06 Mar 2008 14:24

Assigning to "3.30.505.10" based on similarity with "3buxD03"

Flow stage update by auto on 06 Mar 2008 14:24

No in_process hits for Domain "3buxB03" ready to be processed

Update comment by auto on 04 Mar 2008 02:29

Domain "3buxB03" hits Domain "3buxD03" (100% over 100%) which is currently in process

Flow stage update by auto on 04 Mar 2008 02:11

Domain "3buxB03" hits Domain "3buxD03" (100% over 100%) which is currently in process

Flow stage update by auto on 04 Mar 2008 02:11

NW result present for Domain "3buxB03"

Flow stage update by auto on 03 Mar 2008 08:08

All required files are present for Domain "3buxB03"

Flow stage update by auto on 02 Mar 2008 20:39

Beginning processing for Domain "3buxB03"

Insertion by auto on 02 Mar 2008 20:19

Final ChopClose added based on similarity with "2cblA"