CATH Domain: 3buxB02 XML data for domain: 3buxB02

Molscript image for 3buxB02
3buxB02
PDB coordinates for domain 3buxB02

PDB 3bux, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.238 Recoverin; domain 1
1.10.238.10 EF-hand Gene3D
1.10.238.10.6
1.10.238.10.6.1
1.10.238.10.6.1.1
1.10.238.10.6.1.1.1
1.10.238.10.6.1.1.1.1

[top]
Segment boundaries for domain 3buxB02

Chopping figure for domain 3buxB02
DomainStart PDB ResidueStop PDB Residue
3buxB01 47 175
3buxB02 176 264
3buxB03 265 350

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 1.10.238.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1uurA03 84.17 Protein homodimerization activityNucleusSignal transducer and activator of transcription APositive regulation of transcriptionCytosol 1.10.238.10 88 14 85 3.62 4.24
1qx2A00 81.41 Protein S100-GBos taurus 1.10.238.10 75 6 77 3.79 4.89
2f3yA02 80.90 Phosphatidylinositol signaling systemCalcium signaling pathwayOocyte meiosisMelanogenesisInsulin signaling pathway 1.10.238.10 68 10 75 3.37 4.48
1g33A00 80.65 Rattus norvegicusParvalbumin alpha 1.10.238.10 73 15 74 3.11 4.19
1dtlA02 80.29 Cardiac muscle contractionCalcium signaling pathwayTroponin C, slow skeletal and cardiac musclesGallus gallusTroponin C, slow skeletal and cardiac muscles 1.10.238.10 63 11 69 3.17 4.55
1qasA01 79.99 Calcium ion bindingPhosphatidylinositol signaling systemCalcium signaling pathwayRattus norvegicusElevation of cytosolic calcium ion concentration involved in G-protein signaling coupled to IP3 second messenger 1.10.238.10 88 11 92 4.40 4.78
1exrA02 79.59 Phosphatidylinositol signaling systemCalmodulinParamecium tetraureliaCalmodulin 1.10.238.10 67 11 73 2.88 3.94
1tizA00 79.54 Calcium-binding protein CMLArabidopsis thalianaPlant-pathogen interactionProbable calcium-binding protein CML34 1.10.238.10 66 15 73 2.72 3.72
1eg3A04 78.63 Cell surfaceCostamereCytoskeletonDystrophin-associated glycoprotein complexActin binding 1.10.238.10 82 8 78 3.82 4.86
1k90E01 77.83 Phosphatidylinositol signaling systemCalcium signaling pathwayOocyte meiosisMelanogenesisInsulin signaling pathway 1.10.238.10 74 12 82 3.54 4.32
1jfjA01 76.93 Entamoeba histolyticaCalcium-binding protein 1.10.238.10 63 15 69 2.54 3.65
1m45A01 74.84 Vesicle targetingIdentical protein bindingProtein localizationMyosin II heavy chain bindingMyosin light chain 1 1.10.238.10 67 5 66 3.22 4.86
1djxB01 71.80 Calcium ion bindingCalcium signaling pathwayPhosphatidylinositol signaling systemRattus norvegicusElevation of cytosolic calcium ion concentration involved in G-protein signaling coupled to IP3 second messenger 1.10.238.10 52 15 58 2.71 4.64
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3buxB02
GDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLL
RNWNSLAVT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3buxB02
GDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLL
RNWNSLAVT
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 03 Mar 2008 20:31

Assigning to "1.10.238.10" based on similarity with "1b47A02"

Flow stage update by auto on 03 Mar 2008 20:31

No in_process hits for Domain "3buxB02" ready to be processed

Update comment by auto on 03 Mar 2008 20:27

Domain "3buxB02" hits Domain "3buoD02" (100% over 100%) which is currently in process

Update comment by auto on 03 Mar 2008 20:17

Domain "3buxB02" hits Domain "3bumB02" (100% over 100%) which is currently in process

Flow stage update by auto on 03 Mar 2008 20:05

Domain "3buxB02" hits Domain "3bumB02" (100% over 100%) which is currently in process

Flow stage update by auto on 03 Mar 2008 20:05

NW result present for Domain "3buxB02"

Flow stage update by auto on 03 Mar 2008 08:08

All required files are present for Domain "3buxB02"

Flow stage update by auto on 02 Mar 2008 20:39

Beginning processing for Domain "3buxB02"

Insertion by auto on 02 Mar 2008 20:19

Final ChopClose added based on similarity with "2cblA"