CATH Domain: 3buxB01 XML data for domain: 3buxB01

Molscript image for 3buxB01
3buxB01
PDB coordinates for domain 3buxB01

PDB 3bux, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.930 Transcription Elongation Factor S-II; Chain A
1.20.930.20 Gene3D
1.20.930.20.1
1.20.930.20.1.1
1.20.930.20.1.1.1
1.20.930.20.1.1.1.1
1.20.930.20.1.1.1.1.1

[top]
Segment boundaries for domain 3buxB01

Chopping figure for domain 3buxB01
DomainStart PDB ResidueStop PDB Residue
3buxB01 47 175
3buxB02 176 264
3buxB03 265 350

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3buxB01
PPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKT
KQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3buxB01
PPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKT
KQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQ
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 03 Mar 2008 20:42

Assigning to "1.20.930.20" based on similarity with "1b47A01"

Flow stage update by auto on 03 Mar 2008 20:42

No in_process hits for Domain "3buxB01" ready to be processed

Update comment by auto on 03 Mar 2008 20:35

Domain "3buxB01" hits Domain "3buwD01" (100% over 100%) which is currently in process

Update comment by auto on 03 Mar 2008 20:31

Domain "3buxB01" hits Domain "3bunB01" (100% over 99.2248062015504%) which is currently in process

Update comment by auto on 03 Mar 2008 20:27

Domain "3buxB01" hits Domain "3buwB01" (100% over 100%) which is currently in process

Update comment by auto on 03 Mar 2008 20:17

Domain "3buxB01" hits Domain "3bumB01" (100% over 99.2248062015504%) which is currently in process

Flow stage update by auto on 03 Mar 2008 20:05

Domain "3buxB01" hits Domain "3bumB01" (100% over 99.2248062015504%) which is currently in process

Flow stage update by auto on 03 Mar 2008 20:05

NW result present for Domain "3buxB01"

Flow stage update by auto on 03 Mar 2008 08:08

All required files are present for Domain "3buxB01"

Flow stage update by auto on 02 Mar 2008 20:39

Beginning processing for Domain "3buxB01"

Insertion by auto on 02 Mar 2008 20:19

Final ChopClose added based on similarity with "2cblA"