Domain assigned by auto on 28 Apr 2009 11:51
Assigning to "3.30.200.20" based on similarity with "1rqqA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3bu3A01 | 987 | 1078 |
| 3bu3A02 | 1079 | 1281 |
There are 59 matching structural neighberhood comparisons for CATH ID 3.30.200.20.8.1.1.1.1 (SIMAX score < 5)
>pdb|3bu3A01 DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVV SKGQPTLVVMEL
Assigning to "3.30.200.20" based on similarity with "1rqqA01"
No in_process hits for Domain "3bu3A01" ready to be processed
Domain "3bu3A01" hits Domain "3bu5A01" (100% over 100%) which is currently in process
Domain "3bu3A01" hits Domain "3bkbA02" (35.5555555555556% over 85.1485148514851%) which is currently in process
Domain "3bu3A01" hits Domain "3cblA02" (35.5555555555556% over 85.1485148514851%) which is currently in process
Domain "3bu3A01" hits Domain "3bu6A01" (100% over 100%) which is currently in process
Domain "3bu3A01" hits Domain "3bu6A01" (100% over 100%) which is currently in process
NW result present for Domain "3bu3A01"
All required files are present for Domain "3bu3A01"
Beginning processing for Domain "3bu3A01"
Final ChopClose added based on similarity with "1rqqA"