CATH Domain: 3bu3A01 XML data for domain: 3bu3A01

Molscript image for 3bu3A01
3bu3A01
PDB coordinates for domain 3bu3A01

PDB 3bu3, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.200 Phosphorylase Kinase; domain 1
3.30.200.20 Phosphorylase Kinase; domain 1 Gene3D
3.30.200.20.8
3.30.200.20.8.1
3.30.200.20.8.1.1
3.30.200.20.8.1.1.1
3.30.200.20.8.1.1.1.1

[top]
Segment boundaries for domain 3bu3A01

Chopping figure for domain 3bu3A01
DomainStart PDB ResidueStop PDB Residue
3bu3A01 987 1078
3bu3A02 1079 1281

Structural Neighbourhood (59 entries)

There are 59 matching structural neighberhood comparisons for CATH ID 3.30.200.20.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 59 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1lufA01 91.65 Muscle, skeletal receptor tyrosine protein kinaseReceptor clusteringRattus norvegicusResponse to muscle activityMemory 3.30.200.20 97 34 94 1.57 1.66
3cc6A01 91.42 Calcium signaling pathwayChemokine signaling pathwayPositive regulation of cell proliferationProtein-tyrosine kinase 2-betaLeukocyte transendothelial migration 3.30.200.20 90 36 96 2.11 2.18
3eqrB01 90.84 Activated CDC42 kinase 1GTPase inhibitor activitySmall GTPase mediated signal transductionHomo sapiensPositive regulation of peptidyl-tyrosine phosphorylation 3.30.200.20 91 28 96 2.52 2.60
1xbbA01 89.79 T cell receptor complexTyrosine-protein kinase SYKOrgan morphogenesisLeukocyte cell-cell adhesionCell proliferation 3.30.200.20 83 33 89 1.86 2.09
1qpcA01 89.62 Pericentriolar materialPhosphoinositide 3-kinase bindingCD8 receptor bindingT cell receptor signaling pathwayCD4 receptor binding 3.30.200.20 88 37 90 1.88 2.08
1opjA01 89.42 Protein domain specific bindingNucleusPeptidyl-tyrosine phosphorylationManganese ion bindingMus musculus 3.30.200.20 94 39 90 2.30 2.54
3bceA01 89.09 Receptor tyrosine-protein kinase erbB-4Transmembrane receptor protein tyrosine kinase activityHomo sapiensBasolateral plasma membraneProtein binding 3.30.200.20 94 29 93 2.54 2.71
3e64A01 88.29 Jak-STAT signaling pathwayCellular component movementTyrosine-protein kinase JAK2Chemokine signaling pathwayAdipocytokine signaling pathway 3.30.200.20 93 21 96 3.76 3.89
2evaA01 86.93 Positive regulation of T cell cytokine productionActivation of NF-kappaB-inducing kinase activityPositive regulation of interleukin-2 productionMitogen-activated protein kinase kinase kinase 7Protein binding 3.30.200.20 82 25 86 1.72 1.98
2dylA01 86.54 Mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]MAP kinase kinase activityNeurotrophin signaling pathwayStress-activated MAPK cascadeT cell receptor signaling pathway 3.30.200.20 91 18 88 2.40 2.73
2acxA02 86.51 G protein-coupled receptor kinase 6Homo sapiensRegulation of G-protein coupled receptor protein signaling pathway 3.30.200.20 91 20 92 2.40 2.60
1uu3A02 86.49 PPAR signaling pathway3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]Peptidyl-threonine phosphorylationAldosterone-regulated sodium reabsorptionNon-small cell lung cancer 3.30.200.20 93 15 93 2.59 2.77
1fmkA03 86.38 Epithelial cell signaling in Helicobacter pylori infectionPositive regulation of integrin activationRegulation of bone resorptionProto-oncogene tyrosine-protein kinase SrcErbB signaling pathway 3.30.200.20 86 37 89 3.37 3.78
2wtkC01 86.33 NucleusSerine/threonine-protein kinase 11Cell cycle arrestProtein bindingSerine/threonine-protein kinase 11 [EC:2.7.11.9] 3.30.200.20 89 21 85 1.88 2.19
2zv2A01 86.24 Calcium ion bindingRegulation of protein kinase activityPositive regulation of transcriptionMAPKKK cascadeCytoplasm 3.30.200.20 77 24 81 2.84 3.48
3d5vA01 86.06 Danio rerioPolo-like kinase 3.30.200.20 92 22 93 3.62 3.87
2rkuA01 86.03 Polo-like kinase 1 [EC:2.7.11.21]Polo kinase kinase activityProgesterone-mediated oocyte maturationCell proliferationOocyte meiosis 3.30.200.20 89 28 90 2.40 2.66
3comB01 85.98 Transcription factor bindingPathways in cancerNon-small cell lung cancerCytoplasmSerine/threonine-protein kinase 4 3.30.200.20 85 27 86 2.80 3.22
3blhA01 85.98 Transcription elongation from RNA polymerase II promoterCyclin-dependent protein kinase activityRNA polymerase II carboxy-terminal domain kinase activityProtein bindingCell proliferation 3.30.200.20 86 23 89 2.73 3.06
3c4cA01 85.86 Neurotrophin signaling pathwayNon-small cell lung cancerCytoplasmErbB signaling pathwayProtein phosphorylation 3.30.200.20 86 27 90 3.34 3.70
2oibA01 85.83 Chagas diseaseNeurotrophin signaling pathwayInterleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]ApoptosisHomo sapiens 3.30.200.20 93 23 83 2.49 2.97
2j51A01 85.76 CytoplasmOocyte meiosisSTE20-like serine/threonine-protein kinasePlasma membraneHomo sapiens 3.30.200.20 90 20 93 3.31 3.54
1fvrA01 85.58 Cell surfaceMicrovillusTransmembrane receptor protein tyrosine kinase signaling pathwayProtein bindingSignal transduction 3.30.200.20 86 18 90 3.15 3.49
2h6dA01 85.53 Insulin signaling pathwayHypertrophic cardiomyopathy (HCM)Adipocytokine signaling pathwayRegulation of autophagyMTOR signaling pathway 3.30.200.20 86 30 91 3.80 4.16
3hmmA01 85.51 Type II transforming growth factor beta receptor bindingPeptidyl-threonine phosphorylationPositive regulation of cellular component movementPathway-restricted SMAD protein phosphorylationResponse to cholesterol 3.30.200.20 84 20 82 1.97 2.38
1tkiA01 85.45 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 3.30.200.20 84 16 89 3.24 3.64
2r3iA01 85.28 Progesterone-mediated oocyte maturationPathways in cancerSmall cell lung cancerOocyte meiosisProstate cancer 3.30.200.20 76 23 80 2.83 3.52
1ia8A01 85.28 SenescenceReciprocal meiotic recombinationSerine/threonine-protein kinase Chk1Regulation of cyclin-dependent protein kinase activityProtein binding 3.30.200.20 93 22 88 3.97 4.50
3f3zA01 85.26 Cryptosporidium parvum Iowa IICalcium-dependent protein kinase [EC:2.7.11.1]Calcium/calmodulin-dependent protein kinase with a kinase domain and 4 calmodulin like EF hands 3.30.200.20 81 24 88 2.79 3.17
1u5qA01 85.25 Rattus norvegicusThousand and one amino acid protein kinase [EC:2.7.11.1]Serine/threonine-protein kinase TAO2MAPK signaling pathway 3.30.200.20 96 20 89 2.42 2.70
3c0iA01 85.03 Actin cytoskeletonGuanylate kinase activityPeripheral plasma membrane protein CASKCell adhesionHomo sapiens 3.30.200.20 88 22 91 2.97 3.25
2vgpB01 85.03 Serine/threonine-protein kinase 12-AHistone H3-S10 phosphorylationChromosome, centromeric regionProtein bindingChromatin 3.30.200.20 89 15 90 2.70 2.99
1s9jA01 84.98 Prion diseasesNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathwayErbB signaling pathway 3.30.200.20 86 18 92 3.88 4.20
2clqA01 84.73 Induction of apoptosis by extracellular signalsProtein homodimerization activityMitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]Neurotrophin signaling pathwayATP binding 3.30.200.20 85 22 83 2.47 2.95
2weiA01 84.72 Cryptosporidium parvum Iowa IICalmodulin-domain protein kinase 1, putative 3.30.200.20 90 21 93 4.22 4.51
3g0eA01 84.55 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Protein bindingAcute myeloid leukemia 3.30.200.20 131 38 70 2.15 3.06
2jamA01 84.54 Calcium/calmodulin-dependent protein kinase type 1GHomo sapiensCalcium/calmodulin-dependent protein kinase I [EC:2.7.11.17] 3.30.200.20 75 24 81 2.63 3.23
3k3iA01 84.51 Cellular component movementMAP kinase kinase activityProtein bindingChemotaxisMitogen-activated protein kinase 14 3.30.200.20 92 21 90 3.42 3.79
1q5kA01 84.18 Hedgehog signaling pathwayNeurotrophin signaling pathwayAlzheimer's diseaseT cell receptor signaling pathwayER overload response 3.30.200.20 95 20 86 3.36 3.89
3fhrA01 84.17 Response to stressMAP kinase kinase activityNucleusMitogen-activated protein kinase-activated protein kinase 3 [EC:2.7.11.1]MAPK signaling pathway 3.30.200.20 80 21 82 2.51 3.04
2ac3A01 83.86 MAP kinase-interacting serine/threonine-protein kinase 2ATP bindingProtein phosphorylationHomo sapiensProtein serine/threonine kinase activity 3.30.200.20 80 16 84 2.70 3.18
1ob3A01 83.79 Cyclin-dependent kinase [EC:2.7.11.22]Cell division control protein 2 homologPlasmodium falciparum K1 3.30.200.20 83 20 86 3.54 4.07
1zy4A01 83.77 Eukaryotic translation initiation factor 2alpha kinase activityProtein bindingSerine/threonine-protein kinase GCN2DNA damage checkpointRegulation of translational initiation 3.30.200.20 94 17 88 3.62 4.10
3g51A01 83.43 Progesterone-mediated oocyte maturationNeurotrophin signaling pathwayOocyte meiosisMAPK signaling pathwayLong-term potentiation 3.30.200.20 95 17 86 3.60 4.17
2j0iA01 83.35 Cellular component movementT cell receptor signaling pathwaySignal transductionProtein bindingRenal cell carcinoma 3.30.200.20 98 23 86 2.75 3.17
1xwsA01 83.33 Transcription factor bindingPositive regulation of cyclin-dependent protein kinase activity involved in G1/SManganese ion bindingNegative regulation of apoptosisProtein binding 3.30.200.20 92 20 85 2.62 3.05
1kobA01 82.64 Aplysia californicaTwitchin-like protein 3.30.200.20 109 19 78 3.32 4.21
2qkwB01 82.40 Solanum pimpinellifoliumProtein kinaseProtein binding 3.30.200.20 72 26 76 1.83 2.41
2f57B01 82.09 T cell receptor signaling pathwayP21-activated kinase 7 [EC:2.7.11.1]Protein bindingRenal cell carcinomaErbB signaling pathway 3.30.200.20 106 22 79 2.48 3.13
1omwA03 82.03 MembraneG-protein coupled receptor kinase activityNegative regulation of the force of heart contraction by chemical signalChemokine signaling pathwayMuscarinic acetylcholine receptor signaling pathway 3.30.200.20 107 17 77 2.24 2.89
2w5aA01 81.52 NIMA (never in mitosis gene a)-related kinase [EC:2.7.11.1]Regulation of mitosisSerine/threonine-protein kinase Nek2CentrosomeCentrosome separation 3.30.200.20 64 17 66 2.60 3.92
1o6lA02 81.44 Jak-STAT signaling pathwayRAC-beta serine/threonine-protein kinaseNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathway 3.30.200.20 117 18 71 2.41 3.36
3h9rA01 81.43 Positive regulation of osteoblast differentiationBMP signaling pathwayActivin bindingNegative regulation of apoptosisNegative regulation of activin receptor signaling pathway 3.30.200.20 113 15 71 2.25 3.14
1ckiA01 81.29 SpindleRattus norvegicusHedgehog signaling pathwaySoluble fractionCircadian rhythm - mammal 3.30.200.20 64 25 67 2.33 3.46
1rdqE02 80.86 Calcium signaling pathwayPrion diseasesProtein kinase A [EC:2.7.11.11]Olfactory transductionMesoderm formation 3.30.200.20 124 18 70 2.37 3.38
2oo8X01 79.93 Cell surfaceMicrovillusTransmembrane receptor protein tyrosine kinase signaling pathwayProtein bindingSignal transduction 3.30.200.20 60 18 60 2.27 3.73
2jedB01 78.94 Protein kinase C theta typeProtein bindingT cell receptor signaling pathwayNovel protein kinase C [EC:2.7.11.13]Adipocytokine signaling pathway 3.30.200.20 125 18 66 2.35 3.54
1kutB01 76.15 Thermotoga maritimaPhosphoribosylaminoimidazole-succinocarboxamide synthasePurine metabolismPhosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]Metabolic pathways 3.30.200.20 88 9 68 3.06 4.47
3dzoA02 75.29 Toxoplasma gondiiRop2 protein 3.30.200.20 118 8 68 3.40 4.95
[1]
Displaying entries 1 to 59 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bu3A01
DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVV
SKGQPTLVVMEL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bu3A01
VFPSSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCH
HVVRLLGVVSKGQPTLVVMEL
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 28 Apr 2009 11:51

Assigning to "3.30.200.20" based on similarity with "1rqqA01"

Flow stage update by auto on 28 Apr 2009 11:49

No in_process hits for Domain "3bu3A01" ready to be processed

Update comment by auto on 28 Apr 2009 11:42

Domain "3bu3A01" hits Domain "3bu5A01" (100% over 100%) which is currently in process

Update comment by auto on 28 Apr 2009 11:29

Domain "3bu3A01" hits Domain "3bkbA02" (35.5555555555556% over 85.1485148514851%) which is currently in process

Update comment by auto on 28 Apr 2009 11:09

Domain "3bu3A01" hits Domain "3cblA02" (35.5555555555556% over 85.1485148514851%) which is currently in process

Update comment by auto on 28 Apr 2009 08:19

Domain "3bu3A01" hits Domain "3bu6A01" (100% over 100%) which is currently in process

Flow stage update by auto on 28 Apr 2009 08:15

Domain "3bu3A01" hits Domain "3bu6A01" (100% over 100%) which is currently in process

Flow stage update by auto on 28 Apr 2009 08:15

NW result present for Domain "3bu3A01"

Flow stage update by auto on 20 Apr 2009 08:14

All required files are present for Domain "3bu3A01"

Flow stage update by auto on 01 Apr 2009 09:36

Beginning processing for Domain "3bu3A01"

Insertion by auto on 31 Mar 2009 23:03

Final ChopClose added based on similarity with "1rqqA"