CATH Domain: 3bt5A00

3bt5A00

PDB 3bt5, Chain A, Domain 0

CATH Code	Level Description	Links
1	Mainly Alpha
1.20	Up-down Bundle
1.20.1260	Ferritin;
1.20.1260.10		Gene3D
1.20.1260.10.4
1.20.1260.10.4.1
1.20.1260.10.4.1.1
1.20.1260.10.4.1.1.1
1.20.1260.10.4.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3bt5A00

Domain	Start PDB Residue	Stop PDB Residue
3bt5A00	27	179

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.4.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
2qf9A01	88.54	Putative secreted proteinStreptomyces coelicolor	1.20.1260.10	140	30	91	3.27	3.58
2ib0A01	86.79	Mycobacterium tuberculosisCONSERVED HYPOTHETICAL ALANINE RICH PROTEIN	1.20.1260.10	135	11	88	3.26	3.68
1jigA00	86.19	Bacillus anthracisStarvation-inducible DNA-binding proteinDNA protection during starvation protein 1	1.20.1260.10	146	4	90	3.32	3.67
3fvbA00	85.74	BacterioferritinBrucella melitensis biovar Abortus 2308Bacterioferritin	1.20.1260.10	161	10	80	2.51	3.11
2qqyA00	85.68	Bacillus anthracisBacterioferritinPutative uncharacterized protein	1.20.1260.10	133	7	83	2.71	3.26
1lkoA01	85.31	Desulfovibrio vulgaris str. HildenboroughIron ion bindingRubrerythrin	1.20.1260.10	145	8	86	2.57	2.97
2fjcB00	85.23	Treponema pallidumStarvation-inducible DNA-binding proteinAntigen TpF1	1.20.1260.10	156	10	88	3.51	3.97
2yw6B00	84.39	Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein	1.20.1260.10	150	8	88	2.72	3.07
2oh3A01	83.93	Magnetospirillum magneticum AMB-1Uncharacterized conserved protein	1.20.1260.10	132	10	86	3.40	3.93
1tjoB00	82.60	DNA protection during starvation proteinHalobacterium salinarum	1.20.1260.10	175	9	79	3.27	4.12
3kwoA00	82.49	DNA protection during starvation proteinCampylobacter jejuniStarvation-inducible DNA-binding proteinProtein binding	1.20.1260.10	144	4	90	4.40	4.86
1vlgA00	82.46	Porphyrin and chlorophyll metabolismThermotoga maritimaFerritin [EC:1.16.3.1]Ferritin	1.20.1260.10	164	8	79	3.17	3.97
3bvfA00	82.19	Ferritin [EC:1.16.3.1]FerritinPorphyrin and chlorophyll metabolismHelicobacter pylori J99	1.20.1260.10	157	10	76	2.86	3.74
2oc5A01	76.82	Prochlorococcus marinus str. MIT 9313Putative uncharacterized protein	1.20.1260.10	203	8	66	3.04	4.61

[top]
Domain ATOM Sequence

>pdb|3bt5A00
PPATPQEVQFVQHMLQHHAQALDLAAPMLERSQQRTVRSLALDIQLSQREQMRQMEAMLGRWGQPPGEPISPEHARMMGM
ASEAEVAGLSTLPVEQAERQFLRLMIRHHQGAVAMTLPMLDARPEVERLARQIVVTQRGEIRTMEGVLGRL

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3bt5A00
SLRPPLPPATPQEVQFVQHMLQHHAQALDLAAPMLERSQQRTVRSLALDIQLSQREQMRQMEAMLGRWGQPPGEPISPEH
ARMMGMASEAEVAGLSTLPVEQAERQFLRLMIRHHQGAVAMTLPMLDAAARPEVERLARQIVVTQRGEIRTMEGVLGRL

BLAST against CATH

[top]
Domain History Events (46)

Domain assigned by cuff on 10 Feb 2009 15:38

same superfamily

Domain assignment manual match h by cuff on 10 Feb 2009 15:26

same superfamily

Homcheck allotment by cuff on 10 Feb 2009 15:24

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 10 Feb 2009 15:24

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Nov 2008 11:40

Domain "3bt5A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Nov 2008 11:39

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bt5A00

Flow stage update by auto on 28 Nov 2008 11:34

Retrieved PRC_PFAMCATH results for job ID SID9640150022980040 and results inserted.

Domain scan prc pfamcath by auto on 28 Nov 2008 11:33

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 3bt5A00

Update comment by auto on 28 Nov 2008 09:21

PRC_PFAMCATH job SID9640150022980040 is not yet finished.

Flow stage update by auto on 28 Nov 2008 09:18

The entry "3bt5A00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 28 Nov 2008 09:18

The entry "3bt5A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Nov 2008 09:05

Retrieved SSAP results for job ID SID9507318547552256 and results inserted.

Domain scan ssap cath by auto on 28 Nov 2008 08:58

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2406 results for 3bt5A00

Update comment by auto on 27 Nov 2008 07:24

SSAP job SID9507318547552256 is not yet finished.

Ssap cath submit by auto on 27 Nov 2008 07:17

The entry "3bt5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 27 Nov 2008 07:17

The entry "3bt5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 27 Nov 2008 06:58

Retrieved PRC results for job ID SID5822526535983616 and inserted them into the database.

Domain scan prc cath by auto on 27 Nov 2008 06:58

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 3bt5A00

Flow stage update by auto on 27 Nov 2008 06:33

The entry "3bt5A00" has been submitted to the PRC webservice.

Prc cath submit by auto on 27 Nov 2008 06:33

The entry "3bt5A00" has been submitted to the PRC webservice.

Flow stage update by auto on 27 Nov 2008 06:11

Retrieved HMM(SAM) results for job ID SID4437851634301168 and inserted them into the database.

Domain scan sam cath by auto on 27 Nov 2008 06:11

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 3bt5A00