CATH Domain: 3bqxA00 XML data for domain: 3bqxA00

Molscript image for 3bqxA00
3bqxA00
PDB coordinates for domain 3bqxA00

PDB 3bqx, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.180 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1
3.10.180.10 2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 Gene3D
3.10.180.10.2
3.10.180.10.2.1
3.10.180.10.2.1.1
3.10.180.10.2.1.1.1
3.10.180.10.2.1.1.1.1

[top]
Segment boundaries for domain 3bqxA00

Chopping figure for domain 3bqxA00
DomainStart PDB ResidueStop PDB Residue
3bqxA00 3 141

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 3.10.180.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 14 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2rbbA00 86.84 Burkholderia phytofirmans PsJNGlyoxalase/bleomycin resistance protein/dioxygenase 3.10.180.10 126 15 88 2.11 2.37
2a4xA00 86.45 3.10.180.10 131 16 90 2.98 3.29
1f9zA00 83.58 Pyruvate metabolismLactoylglutathione lyase activityNickel ion bindingMethylglyoxal catabolic process to D-lactateLactoylglutathione lyase [EC:4.4.1.5] 3.10.180.10 128 19 82 3.56 4.32
2qntA01 83.21 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 3.10.180.10 109 16 78 2.39 3.04
3ct8A00 82.74 BH2160 proteinBacillus halodurans 3.10.180.10 131 16 84 3.22 3.81
2rk0A01 82.35 Glyoxalase/bleomycin resistance protein/dioxygenaseFrankia sp. EAN1pec 3.10.180.10 119 21 77 2.60 3.34
3huhA01 80.92 Virulence protein STM3117Salmonella enterica subsp. enterica serovar Typhimurium 3.10.180.10 119 15 83 3.28 3.91
2i7rA00 80.90 Conserved domain proteinStreptococcus pneumoniae 3.10.180.10 112 11 80 2.45 3.03
2p25A01 80.63 Glyoxylase I family proteinGlyoxylase family proteinEnterococcus faecalis 3.10.180.10 118 17 75 2.77 3.66
1ecsA00 80.48 Klebsiella pneumoniaeBleomycin resistance protein 3.10.180.10 120 17 83 3.63 4.37
1ss4A00 79.90 Glyoxalase family proteinBacillus cereus ATCC 14579 3.10.180.10 143 11 78 3.50 4.47
3ghjA00 79.74 Uncultured bacteriumPutative integron gene cassette protein 3.10.180.10 114 16 78 3.39 4.31
2qqzA01 79.49 Bacillus anthracisGlyoxalase family protein 3.10.180.10 113 17 77 3.14 4.03
1u6lA01 76.30 Pseudomonas aeruginosaPhnB proteinPutative uncharacterized protein 3.10.180.10 120 14 73 3.42 4.65
[1]
Displaying entries 1 to 14 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bqxA00
LQQVAVITLGIGDLEASARFYGEGFGWAPVFRNPEIIFYQNGFVLATWLVQNLQEDVGVAVTSRPGSALAHNVRAETEVA
PLERLVAAGGQLLRPADAPPHGGLRGYVADPDGHIWEIAFNPVWPIGADGSVTFAA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bqxA00
XSLQQVAVITLGIGDLEASARFYGEGFGWAPVFRNPEIIFYQXNGFVLATWLVQNLQEDVGVAVTSRPGSXALAHNVRAE
TEVAPLXERLVAAGGQLLRPADAPPHGGLRGYVADPDGHIWEIAFNPVWPIGADGSVTFAAKEGHHHHHH
BLAST against CATH

[top]
Domain History Events (66)

Domain assigned by cuff on 25 Mar 2009 16:09

same superfamily

Domain assignment manual match h by cuff on 25 Mar 2009 16:00

same superfamily

Homcheck allotment by cuff on 25 Mar 2009 15:57

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 25 Mar 2009 15:57

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 17:44

Domain "3bqxA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 17:44

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bqxA00

Flow stage update by auto on 19 Mar 2009 14:38

Retrieved PRC_PFAMCATH results for job ID SID9584973418745538 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 14:37

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 48 results for 3bqxA00

Update comment by auto on 05 Mar 2009 11:56

PRC_PFAMCATH job SID9584973418745538 is not yet finished.

Prc pfamcath submit by auto on 05 Mar 2009 11:51

The entry "3bqxA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Mar 2009 11:51

The entry "3bqxA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Mar 2009 10:58

Retrieved SSAP results for job ID SID0666857796306496 and results inserted.

Domain scan ssap cath by auto on 05 Mar 2009 10:55

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 775 results for 3bqxA00

Update comment by auto on 04 Mar 2009 09:13

SSAP job SID0666857796306496 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 08:53

The entry "3bqxA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:53

The entry "3bqxA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 07:05

Retrieved PRC results for job ID SID6976401566055096 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 07:04

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 42 results for 3bqxA00

Update comment by auto on 04 Mar 2009 01:50

PRC job SID6976401566055096 is not yet finished.

Prc cath submit by auto on 04 Mar 2009 01:45

The entry "3bqxA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 01:45

The entry "3bqxA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 01:04

Retrieved HMM(SAM) results for job ID SID2677441611313892 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 01:04

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 31 results for 3bqxA00

Flow stage update by auto on 03 Mar 2009 23:36

The entry "3bqxA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Mar 2009 23:36

The entry "3bqxA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:57

Unable to retrieve "3bqxA00" HMM(SAM) results for job "SID0777242285676912"

Update comment by auto on 19 Feb 2009 08:35

HMM(SAM) job SID0777242285676912 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:07

The entry "3bqxA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:07

The entry "3bqxA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:18

Unable to retrieve "3bqxA00" HMM(SAM) results for job "SID5991577470588610"

Update comment by auto on 22 Jan 2009 17:46

HMM(SAM) job SID5991577470588610 is not yet finished.

Flow stage update by auto on 22 Jan 2009 17:27

The entry "3bqxA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 22 Jan 2009 17:27

The entry "3bqxA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:02

Unable to retrieve "3bqxA00" HMM(SAM) results for job "SID6822033222846352"

Update comment by auto on 03 Dec 2008 11:02

HMM(SAM) job SID6822033222846352 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 10:50

The entry "3bqxA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:50

The entry "3bqxA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 04:35

Retrieved "3bqxA00" CATHEDRAL results for job ID SID2932869997575456 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 04:34

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 39 results for 3bqxA00

Update comment by auto on 03 Dec 2008 00:42

"3bqxA00" CATHEDRAL job SID2932869997575456 is not yet finished.

Flow stage update by auto on 03 Dec 2008 00:13

The entry "3bqxA00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Dec 2008 00:13

The entry "3bqxA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:37

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bqxA00.scanlist" for "3bqxA00"

Write scan list by auto on 02 Dec 2008 23:36

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bqxA00.scanlist" for domain "3bqxA00"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:27

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:30

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 11:55

Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 08:56

Waiting for 355 new domains (example : 3cawA02) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 06:13

Waiting for 387 new domains (example : 3c9fA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 03:58

Waiting for 407 new domains (example : 3c8cA02) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 23:34

Waiting for 439 new domains (example : 3c5mC00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 22:03

Waiting for 476 new domains (example : 3c3jA02) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 17:39

Waiting for 527 new domains (example : 3brcB02) to be processed so that they can be scanned against too.

Flow stage update by auto on 30 Nov 2008 17:38

No satisfactory AssignClose result found.

Flow stage update by auto on 30 Nov 2008 17:13

No in_process hits for Domain "3bqxA00" ready to be processed

Flow stage update by auto on 30 Nov 2008 17:13

NW result present for Domain "3bqxA00"

Flow stage update by auto on 28 Nov 2008 11:13

All required files are present for Domain "3bqxA00"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3bqxA00"

Insertion by cuff on 27 Nov 2008 16:43

nice chopping