CATH Domain: 3bqwA01 XML data for domain: 3bqwA01

Molscript image for 3bqwA01
3bqwA01
PDB coordinates for domain 3bqwA01

PDB 3bqw, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.15 Super Roll
3.15.30 putative capsid protein of prophage fold
3.15.30.10 putative capsid protein of prophage domain like Gene3D
3.15.30.10.1
3.15.30.10.1.1
3.15.30.10.1.1.1
3.15.30.10.1.1.1.1
3.15.30.10.1.1.1.1.1

[top]
Segment boundaries for domain 3bqwA01

Chopping figure for domain 3bqwA01
DomainStart PDB ResidueStop PDB Residue
3bqwA01 5 163
3bqwA01 290 340
3bqwA02 164 289
3bqwA02 341 351

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3bqwA01
AMALNTNQLFAYLNRGDIAEFKFSPLFTTLFFPNVATFSTQNIMLDTLDIEEVTMSAFCSPMVGSQVQRDKGYETSTIKP
GYMKPKHEIDPTKTIMRMAGEDPAQLNDPTYRRMRLITGNMRRQINAIKARVEWLAVNAVTTGKNIIEGEGIERYEIDWK
GLVAYGAIMDQEAVRTGATQNMFYPKNWIEDGDPAIEYVQTHSAPQPVPA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bqwA01
MTVKAMALNTNQLFAYLNRGDIAEFKFSPLFTTLFFPNVATFSTQNIMLDTLDIEEVTMSAFCSPMVGSQVQRDKGYETS
TIKPGYMKPKHEIDPTKTIMRMAGEDPAQLNDPTYRRMRLITGNMRRQINAIKARVEWLAVNAVTTGKNIIEGEGIERYE
IDWKGLVAYGAIMDQEAVRTGATQNMFYPKNWIEDGDPAIEYVQTHSAPQPVPA
BLAST against CATH

[top]
Domain History Events (66)

Domain assigned by cuff on 12 May 2009 14:59

no fold matches

Domain assignment manual match a by cuff on 12 May 2009 14:53

in 3.15 architecture but new fold

Homcheck allotment by cuff on 25 Mar 2009 15:51

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 25 Mar 2009 15:51

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 17:46

Domain "3bqwA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 17:45

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bqwA01

Flow stage update by auto on 19 Mar 2009 14:40

Retrieved PRC_PFAMCATH results for job ID SID9370296124026960 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 14:39

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 3bqwA01

Update comment by auto on 06 Mar 2009 01:55

PRC_PFAMCATH job SID9370296124026960 is not yet finished.

Flow stage update by auto on 06 Mar 2009 01:49

The entry "3bqwA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 06 Mar 2009 01:49

The entry "3bqwA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Mar 2009 01:05

Retrieved SSAP results for job ID SID1862828323389712 and results inserted.

Domain scan ssap cath by auto on 06 Mar 2009 01:04

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 130 results for 3bqwA01

Update comment by auto on 04 Mar 2009 09:13

SSAP job SID1862828323389712 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 08:53

The entry "3bqwA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:53

The entry "3bqwA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 07:05

Retrieved PRC results for job ID SID2508819022116343 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 07:05

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 3bqwA01

Prc cath submit by auto on 04 Mar 2009 06:06

The entry "3bqwA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:06

The entry "3bqwA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 04:18

Retrieved HMM(SAM) results for job ID SID0075885124333808 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 04:17

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3bqwA01

Update comment by auto on 04 Mar 2009 01:04

HMM(SAM) job SID0075885124333808 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:36

The entry "3bqwA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:36

The entry "3bqwA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:57

Unable to retrieve "3bqwA01" HMM(SAM) results for job "SID1079267462351752"

Update comment by auto on 19 Feb 2009 08:35

HMM(SAM) job SID1079267462351752 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:07

The entry "3bqwA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:07

The entry "3bqwA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:18

Unable to retrieve "3bqwA01" HMM(SAM) results for job "SID3264080253070024"

Update comment by auto on 22 Jan 2009 17:46

HMM(SAM) job SID3264080253070024 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:27

The entry "3bqwA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:27

The entry "3bqwA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:02

Unable to retrieve "3bqwA01" HMM(SAM) results for job "SID8126708218607104"

Update comment by auto on 03 Dec 2008 11:02

HMM(SAM) job SID8126708218607104 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 10:50

The entry "3bqwA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:50

The entry "3bqwA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 04:37

Retrieved "3bqwA01" CATHEDRAL results for job ID SID9972186618079608 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 04:35

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 239 results for 3bqwA01

Update comment by auto on 03 Dec 2008 00:43

"3bqwA01" CATHEDRAL job SID9972186618079608 is not yet finished.

Flow stage update by auto on 03 Dec 2008 00:13

The entry "3bqwA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Dec 2008 00:13

The entry "3bqwA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:37

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bqwA01.scanlist" for "3bqwA01"

Write scan list by auto on 02 Dec 2008 23:37

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bqwA01.scanlist" for domain "3bqwA01"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:27

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:30

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 11:55

Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 08:56

Waiting for 355 new domains (example : 3cawA02) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 06:13

Waiting for 387 new domains (example : 3c9fA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 03:58

Waiting for 407 new domains (example : 3c8cA02) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 23:34

Waiting for 439 new domains (example : 3c5mC00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 22:03

Waiting for 476 new domains (example : 3c3jA02) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2008 17:39

Waiting for 527 new domains (example : 3brcB02) to be processed so that they can be scanned against too.

Flow stage update by auto on 30 Nov 2008 17:38

No satisfactory AssignClose result found.

Flow stage update by auto on 30 Nov 2008 17:13

No in_process hits for Domain "3bqwA01" ready to be processed

Flow stage update by auto on 30 Nov 2008 17:13

NW result present for Domain "3bqwA01"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3bqwA01"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3bqwA01"

Insertion by cuff on 27 Nov 2008 16:43

nice chopping