CATH Domain: 3bqsA00 XML data for domain: 3bqsA00

Molscript image for 3bqsA00
3bqsA00
PDB coordinates for domain 3bqsA00

PDB 3bqs, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.20 5' to 3' exonuclease, C-terminal subdomain Gene3D
1.10.150.20.17
1.10.150.20.17.1
1.10.150.20.17.1.1
1.10.150.20.17.1.1.3
1.10.150.20.17.1.1.3.2

[top]
Segment boundaries for domain 3bqsA00

Chopping figure for domain 3bqsA00
DomainStart PDB ResidueStop PDB Residue
3bqsA00 2 86

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.150.20.17.1.1.3.2 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1dgsA05 73.84 DNA ligaseThermus filiformis 1.10.150.20 69 10 64 2.79 4.35
1dxsA00 73.46 DNA damage response, signal transduction resulting in induction of apoptosisTranscription factor bindingProtein bindingPositive regulation of transcription, DNA-dependentMismatch repair 1.10.150.50 57 8 62 3.11 4.94
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bqsA00
SLANLSELPNIGKVLEQDLIKAGIKTPVELKDVGSKEAFLRIWENDSSVCMSELYALEGAVQGIRWHGLDEAKKIELKKF
HQSLE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bqsA00
MSLANLSELPNIGKVLEQDLIKAGIKTPVELKDVGSKEAFLRIWENDSSVCMSELYALEGAVQGIRWHGLDEAKKIELKK
FHQSLEGHHHHHH
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 18 Feb 2009 19:12

Assigning to "1.10.150.20" based on similarity with "3bqtB00"

Flow stage update by auto on 18 Feb 2009 18:48

No in_process hits for Domain "3bqsA00" ready to be processed

Update comment by auto on 18 Feb 2009 18:16

Domain "3bqsA00" hits Domain "3bqtA00" (97.8494623655914% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 11:09

Domain "3bqsA00" hits Domain "3bqtB00" (97.8494623655914% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

Domain "3bqsA00" hits Domain "3bqtB00" (97.8494623655914% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

NW result present for Domain "3bqsA00"

Flow stage update by auto on 20 Nov 2008 11:08

All required files are present for Domain "3bqsA00"

Flow stage update by auto on 19 Nov 2008 17:59

Beginning processing for Domain "3bqsA00"

Insertion by auto on 19 Nov 2008 17:09

Final ChopClose added based on similarity with "3bqtA"