Domain assigned by auto on 20 Jan 2008 05:27
Assigning to "3.30.200.20" based on similarity with "1jwhA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3bqcA01 | 7 | 24 |
| 3bqcA01 | 116 | 330 |
| 3bqcA02 | 25 | 115 |
There are 59 matching structural neighberhood comparisons for CATH ID 3.30.200.20.3.1.1.1.1 (SIMAX score < 5)
>pdb|3bqcA02 DYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDP VSRTPALVFEH
Assigning to "3.30.200.20" based on similarity with "1jwhA01"
NW result present for Domain "3bqcA02"
No in_process hits for Domain "3bqcA02" ready to be processed
All required files are present for Domain "3bqcA02"
Beginning processing for Domain "3bqcA02"
Final ChopClose added based on similarity with "2rkpA"