CATH Domain: 3bp1B02 XML data for domain: 3bp1B02

Molscript image for 3bp1B02
3bp1B02
PDB coordinates for domain 3bp1B02

PDB 3bp1, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1130 GTP Cyclohydrolase I, domain 2
3.30.1130.10 Gene3D
3.30.1130.10.1
3.30.1130.10.1.1
3.30.1130.10.1.1.1
3.30.1130.10.1.1.1.1
3.30.1130.10.1.1.1.1.1

[top]
Segment boundaries for domain 3bp1B02

Chopping figure for domain 3bp1B02
DomainStart PDB ResidueStop PDB Residue
3bp1B01 29 144
3bp1B02 149 287

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.1130.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bp1A01 82.69 7-cyano-7-deazaguanine reductase [EC:1.7.1.13]Vibrio choleraeNADPH-dependent 7-cyano-7-deazaguanine reductase 3.30.1130.10 118 11 71 2.49 3.48
1wurA02 82.33 Thermus thermophilus HB8GTP cyclohydrolase IGTP cyclohydrolase I [EC:3.5.4.16]Folate biosynthesisMetabolic pathways 3.30.1130.10 131 13 77 3.02 3.88
1nbuA00 77.84 Folate biosynthesisMetabolic pathwaysDihydroneopterin aldolase [EC:4.1.2.25]Mycobacterium tuberculosisProbable dihydroneopterin aldolase 3.30.1130.10 118 5 68 2.88 4.21
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bp1B02
TQGECIDDQDIEIANYEFDDALLQGAAQGEEVSEVLHSHLLKSNQPDWGSVEIAYHGAKNREALLRYLVSFREHNEFHEQ
CVERIFTDIRYCQPQSLTVYARYTRRGGLDINPFRSSHQSAPNHNQRARQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bp1B02
TXQGECIDDQDIEIANYEFDDALLQGAAQGEEVSEVLHSHLLKSNCLITNQPDWGSVEIAYHGAKXNREALLRYLVSFRE
HNEFHEQCVERIFTDIXRYCQPQSLTVYARYTRRGGLDINPFRSSHQSAPNHNQRXARQ
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 18 Feb 2009 18:45

Assigning to "3.30.1130.10" based on similarity with "3bp1C02"

Flow stage update by auto on 18 Feb 2009 18:16

No in_process hits for Domain "3bp1B02" ready to be processed

Update comment by auto on 26 Nov 2008 11:09

Domain "3bp1B02" hits Domain "3bp1C02" (97.1223021582734% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

Domain "3bp1B02" hits Domain "3bp1C02" (97.1223021582734% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

NW result present for Domain "3bp1B02"

Flow stage update by auto on 20 Nov 2008 11:08

All required files are present for Domain "3bp1B02"

Flow stage update by auto on 19 Nov 2008 17:59

Beginning processing for Domain "3bp1B02"

Insertion by auto on 19 Nov 2008 17:12

Final ChopClose added based on similarity with "3bp1A"