CATH Domain: 3bp1A01

3bp1A01

PDB 3bp1, Chain A, Domain 1

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.1130	GTP Cyclohydrolase I, domain 2
3.30.1130.10		Gene3D
3.30.1130.10.3
3.30.1130.10.3.1
3.30.1130.10.3.1.1
3.30.1130.10.3.1.1.1
3.30.1130.10.3.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3bp1A01

Domain	Start PDB Residue	Stop PDB Residue
3bp1A01	27	144
3bp1A02	149	287

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.1130.10.3.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1b9lA00	78.36	Folic acid-containing compound metabolic processDihydroneopterin triphosphate 2'-epimerase activityD-erythro-7,8-dihydroneopterin triphosphate epimerase [EC:5.-.-.-]D-erythro-7,8-dihydroneopterin triphosphate epimeraseProtein binding	3.30.1130.10	119	8	75	3.63	4.80

[top]
Domain ATOM Sequence

>pdb|3bp1A01
YANQYDPSLLQPVPRSLNRNDLHLSATLPFQGCDIWTLYELSWLNQKGLPQVAIGEVSIPATSANLIESKSFKLYLNSYN
QTRFASWDEVQTRLVHDLSACAGETVTVNVKSLNEYTA

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3bp1A01
YANQYDPSLLQPVPRSLNRNDLHLSATLPFQGCDIWTLYELSWLNQKGLPQVAIGEVSIPATSANLIESKSFKLYLNSYN
QTRFASWDEVQTRLVHDLSACAGETVTVNVKSLNEYTA

BLAST against CATH

[top]
Domain History Events (46)

Domain assigned by cuff on 26 Feb 2009 11:26

same superfamily

Domain assignment manual match h by cuff on 26 Feb 2009 11:25

homology match

Homcheck allotment by cuff on 10 Feb 2009 14:11

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 10 Feb 2009 14:11

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Nov 2008 01:00

Domain "3bp1A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Nov 2008 00:59

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bp1A01

Flow stage update by auto on 28 Nov 2008 00:29

Retrieved PRC_PFAMCATH results for job ID SID7524918251026800 and results inserted.

Domain scan prc pfamcath by auto on 28 Nov 2008 00:28

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2 results for 3bp1A01

Update comment by auto on 27 Nov 2008 22:12

PRC_PFAMCATH job SID7524918251026800 is not yet finished.

Flow stage update by auto on 27 Nov 2008 22:09

The entry "3bp1A01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 27 Nov 2008 22:09

The entry "3bp1A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Nov 2008 21:39

Retrieved SSAP results for job ID SID4137322415008128 and results inserted.

Domain scan ssap cath by auto on 27 Nov 2008 21:36

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2638 results for 3bp1A01

Update comment by auto on 27 Nov 2008 07:23

SSAP job SID4137322415008128 is not yet finished.

Ssap cath submit by auto on 27 Nov 2008 07:16

The entry "3bp1A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 27 Nov 2008 07:16

The entry "3bp1A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 27 Nov 2008 06:51

Retrieved PRC results for job ID SID7591017074797840 and inserted them into the database.

Domain scan prc cath by auto on 27 Nov 2008 06:51

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 3bp1A01

Prc cath submit by auto on 27 Nov 2008 06:31

The entry "3bp1A01" has been submitted to the PRC webservice.

Flow stage update by auto on 27 Nov 2008 06:31

The entry "3bp1A01" has been submitted to the PRC webservice.

Flow stage update by auto on 27 Nov 2008 06:06

Retrieved HMM(SAM) results for job ID SID2866731597629520 and inserted them into the database.

Domain scan sam cath by auto on 27 Nov 2008 06:05

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3bp1A01