CATH Domain: 3bosA02

3bosA02

PDB 3bos, Chain A, Domain 2

CATH Code	Level Description	Links
1	Mainly Alpha
1.10	Orthogonal Bundle
1.10.8	Helicase, Ruva Protein; domain 3
1.10.8.60		Gene3D
1.10.8.60.10
1.10.8.60.10.1
1.10.8.60.10.1.1
1.10.8.60.10.1.1.1
1.10.8.60.10.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3bosA02

Domain	Start PDB Residue	Stop PDB Residue
3bosA01	12	172
3bosA02	175	241

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 1.10.8.60.10.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
1njgA02	86.74	Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination	1.10.8.60	66	10	89	2.53	2.83
2z4sA02	85.43	Thermotoga maritimaTwo-component systemChromosomal replication initiator proteinChromosomal replication initiator protein dnaA	1.10.8.60	72	16	81	2.17	2.65
1njgB01	84.46	Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination	1.10.8.60	73	10	80	2.61	3.23
1jqjD03	83.98	Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination	1.10.8.60	86	23	68	1.98	2.89
1jr3D03	82.81	Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination	1.10.8.60	71	15	81	2.71	3.32
2chgA02	79.89	Archaeoglobus fulgidusReplication factor C small subunitReplication factor C small subunit	1.10.8.60	66	8	80	3.29	4.10
1ny5B03	79.73	Transcriptional regulator (NtrC family)Two-component system, NtrC family, response regulatorAquifex aeolicus	1.10.8.60	74	13	79	2.89	3.62
1sxjE02	79.14	Leading strand elongationNucleotide excision repairDNA replicationReplication factor C subunit 3/5Sister chromatid cohesion	1.10.8.60	64	11	82	3.65	4.41
1e32A04	77.72	Mus musculusPolyubiquitin bindingProtein complexAggresome assemblyTransitional endoplasmic reticulum ATPase	1.10.8.60	87	10	67	3.38	4.98
1fnnA01	77.63	Pyrobaculum aerophilumCell division control protein 6 (Cdc6), putativeArchaeal cell division control protein 6	1.10.8.60	101	23	58	2.43	4.16
1l8qA02	76.47	Two-component systemChromosomal replication initiator proteinChromosomal replication initiator protein dnaAAquifex aeolicus	1.10.8.60	49	10	72	2.42	3.32
3bg5B07	76.06	Citrate cycle (TCA cycle)Pyruvate metabolismMetabolic pathwaysPyruvate carboxylase subunit A [EC:6.4.1.1]Pyruvate carboxylase subunit B [EC:6.4.1.1]	1.10.10.60	46	4	69	3.33	4.79
1s26D01	73.97	Calcium signaling pathwayPhosphatidylinositol signaling systemOocyte meiosisMelanogenesisInsulin signaling pathway	1.10.238.10	59	6	64	3.13	4.86

[top]
Domain ATOM Sequence

>pdb|3bosA02
DDEKLAALQRRAARGLQLPEDVGRFLLNRARDLRTLFDVLDRLDKASVHQRKLTIPFVKELRL

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3bosA02
DDEKLAALQRRAAXRGLQLPEDVGRFLLNRXARDLRTLFDVLDRLDKASXVHQRKLTIPFVKEXLRL

BLAST against CATH

[top]
Domain History Events (46)

Domain assigned by cuff on 10 Feb 2009 14:10

homology match

Domain assignment manual match h by cuff on 10 Feb 2009 14:08

same superfamily

Homcheck allotment by cuff on 10 Feb 2009 14:06

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 10 Feb 2009 14:06

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Nov 2008 00:57

Domain "3bosA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Nov 2008 00:56

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bosA02

Flow stage update by auto on 28 Nov 2008 00:25

Retrieved PRC_PFAMCATH results for job ID SID6462424109228688 and results inserted.

Domain scan prc pfamcath by auto on 28 Nov 2008 00:24

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 60 results for 3bosA02

Update comment by auto on 27 Nov 2008 15:17

PRC_PFAMCATH job SID6462424109228688 is not yet finished.

Prc pfamcath submit by auto on 27 Nov 2008 15:16

The entry "3bosA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Nov 2008 15:16

The entry "3bosA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Nov 2008 15:03

Retrieved SSAP results for job ID SID9046987625548768 and results inserted.

Domain scan ssap cath by auto on 27 Nov 2008 14:58

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2538 results for 3bosA02

Update comment by auto on 27 Nov 2008 07:22

SSAP job SID9046987625548768 is not yet finished.

Ssap cath submit by auto on 27 Nov 2008 07:15

The entry "3bosA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 27 Nov 2008 07:15

The entry "3bosA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 27 Nov 2008 06:48

Retrieved PRC results for job ID SID6066916336999648 and inserted them into the database.

Domain scan prc cath by auto on 27 Nov 2008 06:48

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 3bosA02

Prc cath submit by auto on 27 Nov 2008 06:30

The entry "3bosA02" has been submitted to the PRC webservice.

Flow stage update by auto on 27 Nov 2008 06:30

The entry "3bosA02" has been submitted to the PRC webservice.

Flow stage update by auto on 27 Nov 2008 06:03

Retrieved HMM(SAM) results for job ID SID8006508303729008 and inserted them into the database.

Domain scan sam cath by auto on 27 Nov 2008 06:03

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3bosA02